close all open/close all

CDS information : Tetrn_00180


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction83,715 / 82,294 / - [in whole cluster]
83,715 / 82,294 / - [in contig]
Locationcomplement(82294..83715) [in whole cluster]
complement(82294..83715) [in contig]
TypeCDS
Length1,422 bp (473 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
Product (GenBank)putative tetronomycin epoxidase
Gene
Gene (GenBank)tmnC
EC number
Keyword
Note
Note (GenBank)
  • homologue of MonCI protein of polyether monensin biosynthetic cluster
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
B5M9L6
NITE
Lasal_00200
PmId
[22506807] Sequential enzymatic epoxidation involved in polyether lasalocid biosynthesis. (J Am Chem Soc. , 2012)
[23796908] Biosynthetic machinery of ionophore polyether lasalocid: enzymatic construction of polyether skeleton. (Curr Opin Chem Biol. , 2013)
ACC
B5M9L6
NITE
Lasal2_00240
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative epoxidase [putative tetronomycin epoxidase]
MAEATRGPNTRVHGVVLGGGLAGVLAARALRDHVDHVTVVERDTYPDLTEPRKGVPQGRH
AHILWSGGAEAIEELLPGTLDRLRAAGAHRIGVKEDMVLYSAYGWQHRFPGSHYALTCSR
PLLDRTVREAALDHPDTEVLTRTEAHGLLGDRTSVTGVRVRTSDGATRELPADIVVDATG
RGSRLRHWLTDLGLPPAAEESVDTGLTYATRVFRAPAGAPGAFPVVSVYADHRSGEPGRN
GLLLPIEDGRWIITLSGTRGGEPTADEERFATFARSLRDPIIADLIEAAEPLTPVRTTRS
TLNRRMHLDRLADRPEGLVALGDCVVSLNPIHGHGMSVAARSARALEACLSRAGGLKPGL
ARTAQQAIAAAADAPWLLSASQDLCYPDNKAAVSDPRLTTQAAQRQGFADMVTSASLVNE
RVCDALTAVTTLTAPLGSLETPEFLAAMRQPARPPLTAAPLKDAEAAVLRAAK
selected fasta
>putative epoxidase [putative tetronomycin epoxidase]
ATGGCGGAAGCAACCCGTGGCCCGAACACCCGAGTTCACGGAGTCGTACTCGGGGGCGGG
CTCGCCGGCGTGCTCGCCGCCCGGGCACTGCGGGACCACGTCGACCACGTCACCGTGGTC
GAACGCGACACCTACCCGGACCTGACCGAGCCCCGCAAGGGCGTCCCGCAGGGCCGGCAC
GCGCACATCCTCTGGTCCGGTGGCGCCGAGGCCATCGAGGAGCTGCTCCCCGGCACCCTG
GACCGGCTGCGCGCCGCCGGCGCCCACCGCATCGGCGTCAAGGAGGACATGGTCCTCTAC
AGCGCCTACGGCTGGCAGCACCGCTTCCCCGGCTCCCACTACGCGCTCACCTGCAGCCGC
CCCCTCCTCGACCGGACGGTCCGCGAGGCCGCGCTGGACCACCCGGACACCGAGGTGCTG
ACGCGGACCGAGGCGCACGGGCTGCTCGGCGACCGTACGAGCGTCACGGGCGTACGCGTG
CGCACCTCCGACGGCGCCACGCGCGAGCTGCCCGCCGACATCGTCGTCGACGCCACCGGC
CGCGGCTCCCGGCTGCGGCACTGGCTCACCGACCTAGGCCTGCCGCCCGCCGCCGAGGAG
AGCGTCGACACCGGCCTCACCTACGCCACCCGCGTCTTCCGCGCCCCCGCCGGCGCCCCC
GGGGCCTTCCCCGTCGTCAGCGTCTACGCCGACCACCGCAGCGGCGAACCGGGGCGCAAC
GGCCTGCTCCTGCCCATCGAGGACGGCCGCTGGATCATCACCCTCTCCGGCACCCGCGGC
GGCGAGCCGACGGCCGACGAGGAGCGCTTCGCCACCTTCGCCCGCAGCCTGCGCGACCCG
ATCATCGCCGACCTGATCGAGGCCGCCGAGCCGTTGACGCCGGTGCGCACCACCCGCAGC
ACCCTCAACCGCCGCATGCACCTCGACCGCCTCGCCGACCGCCCCGAAGGTCTCGTCGCG
CTCGGCGACTGCGTGGTGTCCCTCAACCCCATCCACGGCCACGGCATGAGCGTCGCCGCC
CGGTCCGCCAGGGCCCTGGAGGCCTGCCTGAGCCGCGCCGGCGGCCTGAAGCCCGGCCTG
GCCCGCACGGCGCAGCAGGCCATCGCCGCCGCCGCCGACGCGCCGTGGCTGCTCTCCGCC
TCCCAGGACCTGTGCTACCCCGACAACAAGGCCGCCGTCAGCGATCCGCGCCTGACCACC
CAGGCCGCGCAGCGGCAGGGGTTCGCCGACATGGTCACCAGCGCCTCCCTCGTCAACGAG
CGCGTCTGCGACGCCCTCACGGCCGTCACCACGCTCACCGCACCGCTGGGCAGCCTGGAG
ACGCCCGAGTTCCTCGCGGCGATGCGGCAGCCGGCCCGGCCGCCCCTGACCGCGGCGCCG
CTGAAGGACGCGGAGGCCGCGGTGCTGCGGGCGGCGAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [15-348]  3.4e-10 PF01494
PF01494   FAD_binding_3
SignalP
 [1-29]  0.78 Signal
Eukaryota   
 [1-29]  0.35 Signal
Bacteria, Gram-positive   
TMHMM No significant hit