close all open/close all

CDS information : Tetrn_00190


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction83,903 / 84,145 / + [in whole cluster]
83,903 / 84,145 / + [in contig]
Location83903..84145 [in whole cluster]
83903..84145 [in contig]
TypeCDS
Length243 bp (80 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)putative ferredoxin
Gene
Gene (GenBank)tmn14a
EC number
Keyword
  • C-28 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
P18325
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [putative ferredoxin]
MRDSSMQVETEIERCVASGMCTLLAPEVFDQDEVTGQVVVLVKRPAEEQWEAVDEAVRSC
PGQVVRFEEAAEPAGAAEAP
selected fasta
>putative ferredoxin [putative ferredoxin]
ATGCGGGATTCCTCCATGCAGGTCGAGACCGAGATCGAGCGGTGCGTGGCATCTGGCATG
TGCACGCTCCTGGCGCCGGAGGTCTTCGACCAGGATGAGGTGACAGGTCAGGTCGTGGTG
CTGGTGAAGCGCCCGGCCGAGGAGCAGTGGGAGGCGGTGGACGAGGCCGTGCGCTCCTGC
CCGGGCCAGGTCGTCCGGTTCGAGGAGGCGGCCGAGCCGGCCGGGGCGGCCGAGGCGCCT
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit