close all open/close all

CDS information : Tetrn_00200


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction84,250 / 85,452 / + [in whole cluster]
84,250 / 85,452 / + [in contig]
Location84250..85452 [in whole cluster]
84250..85452 [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450-like protein
Gene
Gene (GenBank)tmn14
EC number
Keyword
  • C-28 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
A6YRR3
PmId
[19376895] Characterization of P450 FcpC, the enzyme responsible for bioconversion of diosgenone to isonuatigenone in Streptomyces virginiae IBL-14. (Appl Environ Microbiol. , 2009)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450-like protein]
MSDTLSTPPRRLPTERPRPLDPPEELGRLRAEEPVSPLLYPDGHVGWLVTSHAAARKVLS
DQRFSARGDIKKVPFELPSGGRPWEKVPPGFFMHMDPPDHTRYRRLLTGQFTVRRMKALE
PRIEQITEEHLDEMERQGPPTDLVPSFALPIPSLAICELLGVPYGERQRFQDHSTTVMRI
GSTGEEVAAAFAAIYGLIHELVQLKHKEPEDDLLSGLIATGELDDAELTGIGMLLLMAGH
ETTASMLSLGTYALLRHPGEVKRLREDPKLFANAVEELMRYLTIAQFGVPRTALEDVELE
GKLIKAGDGVTVSLAAANRDPGRFEDADGFDVGRSTSGHMAFSYGIHQCLGQQLARVEMR
IAYSALFRRFPELRLAVDADEVPLRAEATMYAASSLPVAW
selected fasta
>putative cytochrome P450 [putative cytochrome P450-like protein]
ATGTCGGACACGCTGTCCACGCCGCCCCGGCGGTTGCCGACCGAGCGCCCGCGCCCGCTG
GACCCGCCGGAAGAGCTGGGCCGGCTGCGTGCCGAGGAGCCGGTCAGCCCGCTGCTGTAC
CCGGACGGGCACGTGGGCTGGCTGGTGACGAGCCACGCCGCGGCCCGGAAGGTGCTCAGC
GACCAGCGGTTCAGCGCCCGGGGCGACATCAAGAAGGTGCCGTTCGAGCTGCCCTCCGGC
GGTCGGCCGTGGGAGAAGGTGCCGCCCGGCTTCTTCATGCACATGGACCCGCCGGACCAC
ACCCGCTACCGGCGGCTGCTCACCGGCCAGTTCACGGTGCGGCGGATGAAGGCGCTGGAG
CCGCGGATCGAGCAGATCACCGAGGAGCACCTGGACGAGATGGAGCGGCAGGGGCCGCCC
ACGGACCTGGTGCCCTCGTTCGCGCTGCCGATCCCCTCGCTGGCCATCTGCGAGCTGCTG
GGCGTCCCGTACGGCGAGCGCCAGCGCTTCCAGGACCACTCGACGACCGTGATGCGCATC
GGCTCGACCGGCGAGGAGGTGGCGGCGGCCTTCGCCGCGATCTACGGGCTGATCCACGAG
CTGGTGCAGCTCAAGCACAAGGAGCCCGAGGACGACCTGCTCAGCGGGCTGATCGCCACC
GGCGAGCTGGACGACGCGGAGCTGACCGGCATCGGGATGCTGCTGCTGATGGCGGGGCAC
GAGACGACCGCCAGCATGCTGTCGCTCGGCACGTACGCGCTGCTGCGCCACCCCGGCGAG
GTCAAGCGGCTGCGCGAGGACCCGAAGCTGTTCGCCAACGCGGTCGAGGAGCTGATGCGG
TATCTGACGATCGCCCAGTTCGGCGTGCCGCGTACCGCGCTGGAGGACGTCGAGCTGGAG
GGCAAGCTCATCAAGGCCGGCGACGGCGTGACGGTGTCCCTGGCGGCGGCCAACCGCGAC
CCGGGGCGCTTCGAGGACGCGGACGGCTTCGACGTCGGCCGCTCCACCTCCGGGCACATG
GCGTTCAGCTACGGCATCCACCAGTGCCTGGGCCAGCAGCTGGCCCGGGTGGAGATGCGG
ATCGCGTACTCGGCGCTCTTCCGCCGGTTCCCCGAGCTGCGCCTCGCGGTCGACGCGGAC
GAGGTGCCGCTGCGCGCGGAGGCGACGATGTACGCCGCGAGTTCCCTCCCGGTGGCCTGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [196-370]  2.80000000000001e-28 PF00067
PF00067   p450
 [8-400]  2.50000909916183e-103 SSF48264
SSF48264   Cytochrome_P450
 [238-255]  6.99999965558827e-08 PR00385 [273-284]  6.99999965558827e-08 PR00385 [340-349]  6.99999965558827e-08 PR00385 [349-360]  6.99999965558827e-08 PR00385
PR00385   P450
 [19-400]  2.39999999999997e-108 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [95-106]  6.79998707392899e-56 PR00359 [142-158]  6.79998707392899e-56 PR00359 [159-174]  6.79998707392899e-56 PR00359 [196-218]  6.79998707392899e-56 PR00359 [273-284]  6.79998707392899e-56 PR00359 [291-318]  6.79998707392899e-56 PR00359 [319-334]  6.79998707392899e-56 PR00359 [340-349]  6.79998707392899e-56 PR00359 [349-360]  6.79998707392899e-56 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [342-351]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit