close all open/close all

CDS information : Tetrn_00210


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction85,457 / 86,497 / + [in whole cluster]
85,457 / 86,497 / + [in contig]
Location85457..86497 [in whole cluster]
85457..86497 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyltransferase
Product (GenBank)putative 3-oxoacyl-(acyl-carrier-protein) synthase III
Gene
Gene (GenBank)tmn15
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
P68795
PmId
[11959561] Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl carrier protein synthase III (FabH) from Staphylococcus aureus. (Antimicrob Agents Chemother. , 2002)

close this sectionSequence

selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl-carrier-protein) synthase III]
MLVLNPEQDLRVAGLGTASPGPQIDNATLGRRMGLGPMWEQWAEAFVGTKYRHLAVDLET
GEPRFSLADLGETAGRRALAAAGMEPSDVDVIVMGTAMPDMLMPTTVNVVADRLGIDQVP
TYQLQSGCSGAVQALSVAAGLLLSGSHRTALVLGGDVSAKLVDPDMDAAALPPAQLVNLM
LFGDGAGALVLTAEPSPGPALRAVFTKLVGLGRQPGQTLDWYGASRRFDGPPVSEDYKAI
EAAVPEMAAESAEELLGGLDWKADELAYVLPPQLSGRMTALIRERMGAPEAQEVSCVDET
GNNGNALVFFQLARLLPKLTAGDRALGVAIESSKWIKSGFALEATA
selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl-carrier-protein) synthase III]
GTGCTCGTTCTGAACCCGGAGCAGGACCTGCGGGTCGCCGGCCTCGGCACGGCGTCGCCG
GGACCGCAGATCGACAACGCGACGCTGGGCCGCCGCATGGGCCTCGGCCCGATGTGGGAG
CAGTGGGCGGAGGCGTTCGTCGGCACCAAGTACCGCCATCTCGCGGTGGATCTGGAGACC
GGCGAGCCGCGGTTCTCGCTCGCCGACCTCGGCGAGACCGCCGGCCGGCGGGCGCTGGCC
GCGGCGGGCATGGAGCCGTCGGACGTCGACGTGATCGTGATGGGCACGGCGATGCCCGAC
ATGCTGATGCCGACGACGGTGAACGTGGTCGCGGACCGGCTGGGCATCGACCAGGTGCCC
ACGTACCAGCTGCAGTCCGGGTGCTCGGGCGCGGTGCAGGCGCTGTCGGTGGCGGCGGGG
CTGCTGCTGTCCGGCAGCCACCGCACGGCACTGGTGCTCGGCGGCGACGTCTCGGCGAAG
CTCGTCGACCCGGACATGGACGCCGCCGCGCTGCCGCCCGCGCAGCTGGTGAACCTCATG
CTGTTCGGCGACGGCGCCGGCGCGCTGGTGCTGACGGCGGAGCCGTCGCCCGGGCCGGCG
CTGCGGGCGGTCTTCACCAAGCTCGTGGGGCTGGGCCGTCAGCCCGGGCAGACGCTCGAC
TGGTACGGCGCGAGCCGCCGGTTCGACGGCCCGCCGGTGAGCGAGGACTACAAGGCGATC
GAGGCGGCCGTGCCGGAGATGGCCGCCGAGTCGGCCGAGGAACTCCTAGGCGGGCTGGAC
TGGAAGGCGGACGAGCTGGCGTACGTGCTGCCGCCGCAGCTCTCGGGCCGGATGACGGCG
CTGATCCGGGAGCGGATGGGTGCGCCCGAGGCCCAGGAGGTCTCCTGCGTCGACGAGACC
GGCAACAACGGCAACGCGCTGGTCTTCTTCCAGCTGGCGCGGCTGCTGCCGAAGCTCACC
GCGGGCGATCGCGCGCTGGGGGTCGCCATCGAGTCGAGCAAGTGGATCAAGTCGGGCTTC
GCGCTGGAGGCGACCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [260-329]  8.20000000000001e-07 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [124-198]  3.3e-15 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [7-187]  7.00000000000005e-38 G3DSA:3.40.47.10 [188-330]  8.80000000000003e-19 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-201]  1e-37 SSF53901 [217-332]  1.89999859865864e-15 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit