close all open/close all

CDS information : Tetrn_00220


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction86,793 / 88,694 / + [in whole cluster]
86,793 / 88,694 / + [in contig]
Location86793..88694 [in whole cluster]
86793..88694 [in contig]
TypeCDS
Length1,902 bp (633 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productglyceroyl-ACP biosynthesis protein
1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn16
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • 38% identity with the predicted enzyme involved in methoxymalonyl-ACP biosynthesis from Nostoc punctiforme (ZP_00110100.1)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
[18046685] Glyceryl-S-acyl carrier protein as an intermediate in the biosynthesis of tetronate antibiotics. (Chembiochem. , 2008)
Related Reference
ACC
Q0R4L8
NITE
Chth_00360
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>glyceroyl-ACP biosynthesis protein [hypothetical protein]
MSAAPAPPPTAPDPVAELHRSGSLVAEYPRLPALLRELGENERQRAGRLLSRLSPDEVLA
AHPGIPTVSVAVTGHGTVAGLVPPLTMELARHGMLLRPHVADFGGWLFDLADPASEVYAA
GTDLVVCLPAAGIVFDEVPRPWRPEDVERVLTEKVHLLGKLAATHGTSGSGTLVYTTMPL
PREFTSQLVDHRSRARLGAVWREGNARLLGLMDEHPGLVVLDLDPVLSGPAALAEPRLET
YAGTPFAAELTAAVAREVAHLARGRSGRAKKVLAVDLDNTLWGGVLGDDGPEGIEVADGR
TGRAFQRMQRVVKQLASRGVLVAAVSKNDLEPVREVLREHQEMTLREDDFVRVVANWAPK
HDNLRALAEDLNVGLDSFVFADDSPYECGLVASELPEVTVLHLDGDPALHAERLLADGWF
DVRDLTDDDVRRPERYREELVRKDFLDSFSSLDDYLRELDVRVELSAAAEADVPRVAQLT
QRTNQFNLTTRRLQQDEVASLAGSPGNMVLAIRCGDRFGDNGLVGAVFVRTDGPVWHVDN
FLLSCRVFARGIEQGCLAALLEHARAEGAEAVAARYVPSTKNGKVRDFYPRNGFDAHGQS
EDGTADFRHELLEIGAVPGHLDLTVRWEQEGTR
selected fasta
>glyceroyl-ACP biosynthesis protein [hypothetical protein]
GTGTCCGCTGCCCCCGCTCCCCCGCCCACCGCTCCGGATCCCGTCGCGGAGCTGCACCGG
TCCGGCAGCCTGGTCGCGGAGTACCCGAGACTCCCCGCGCTGCTCCGGGAGCTCGGCGAG
AACGAACGGCAGCGCGCCGGGCGGCTGCTGTCCCGCCTGTCCCCCGACGAGGTGCTCGCG
GCCCACCCCGGCATCCCGACGGTGTCCGTCGCGGTGACCGGGCACGGCACGGTCGCCGGC
CTCGTGCCGCCGCTCACCATGGAGCTGGCCCGGCACGGCATGCTGCTGCGCCCCCACGTC
GCGGACTTCGGCGGCTGGCTCTTCGACCTCGCGGACCCCGCCAGCGAGGTCTACGCCGCC
GGCACCGACCTCGTGGTGTGCCTGCCGGCCGCCGGGATCGTCTTCGACGAGGTGCCGCGC
CCGTGGCGGCCCGAGGACGTCGAGCGGGTGCTGACCGAGAAGGTGCACCTCCTCGGCAAG
CTCGCCGCCACCCACGGCACTTCGGGCTCCGGCACCCTCGTCTACACCACGATGCCGCTC
CCCCGGGAGTTCACCTCCCAGCTCGTGGACCACCGCTCCCGCGCCCGGCTCGGCGCCGTG
TGGCGCGAGGGCAACGCGCGGCTGCTCGGGCTCATGGACGAGCACCCCGGTCTCGTGGTC
CTCGATCTCGACCCGGTCCTCTCCGGGCCCGCGGCCCTCGCCGAGCCCCGCCTGGAGACC
TACGCCGGCACGCCCTTCGCCGCGGAGCTGACCGCCGCCGTCGCGCGCGAGGTCGCGCAC
CTCGCCCGCGGCCGGTCGGGGCGGGCGAAGAAGGTACTCGCGGTCGACCTGGACAACACC
CTGTGGGGCGGCGTGCTCGGCGACGACGGCCCGGAGGGCATCGAGGTCGCCGACGGCCGT
ACGGGGCGCGCGTTCCAGCGCATGCAGCGCGTGGTCAAGCAGCTCGCCTCGCGCGGGGTG
CTCGTGGCCGCCGTCAGCAAGAACGACCTGGAGCCCGTGCGCGAGGTGCTCCGCGAGCAC
CAGGAGATGACGCTGCGCGAGGACGACTTCGTCCGGGTGGTCGCCAACTGGGCGCCCAAG
CACGACAACCTGCGCGCGCTCGCCGAGGACCTCAACGTGGGCCTCGACTCGTTCGTCTTC
GCCGACGACAGCCCGTACGAGTGCGGCCTGGTGGCCAGCGAGCTGCCCGAGGTCACCGTG
CTCCACCTCGACGGCGACCCGGCGCTGCACGCCGAACGGCTGCTGGCCGACGGCTGGTTC
GACGTGCGCGACCTCACCGACGACGACGTCCGCCGCCCCGAGCGCTACCGCGAGGAGCTG
GTCCGCAAGGACTTCCTCGACTCCTTCTCGTCGCTCGACGACTACCTGCGGGAGCTGGAC
GTACGGGTCGAGCTGAGCGCCGCCGCGGAGGCCGACGTGCCGCGCGTGGCCCAGCTCACC
CAGCGCACCAACCAGTTCAACCTGACCACGCGGCGGCTCCAGCAGGACGAGGTCGCCTCC
CTGGCCGGCTCGCCGGGGAACATGGTGCTGGCCATCCGCTGCGGCGACCGCTTCGGGGAC
AACGGACTGGTCGGTGCGGTGTTCGTACGGACCGACGGGCCCGTGTGGCACGTCGACAAC
TTCCTGCTGAGCTGCCGGGTCTTCGCCCGCGGCATCGAGCAGGGCTGCCTCGCCGCGCTG
CTGGAGCACGCCCGGGCCGAGGGGGCCGAGGCCGTGGCGGCGCGGTACGTGCCGTCGACG
AAGAACGGCAAGGTCAGGGACTTCTATCCACGGAACGGCTTCGACGCCCACGGGCAGTCC
GAGGACGGGACGGCCGACTTCCGGCACGAGCTGCTGGAGATCGGCGCGGTGCCCGGCCAC
CTCGATCTGACGGTGCGCTGGGAGCAGGAGGGAACACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [472-594]  4.5e-05 PF13673
PF13673   Acetyltransf_10
 [463-624]  PS51186
PS51186   GNAT
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [271-391]  1.99999999999999e-18 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [269-595]  6.40000000000004e-93 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [462-601]  6.20000124972815e-10 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [463-602]  1.3e-09 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [271-385]  2.1e-07 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [269-428]  2.19999900980708e-11 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit