close all open/close all

CDS information : Tetrn_00230


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction88,691 / 89,728 / + [in whole cluster]
88,691 / 89,728 / + [in contig]
Location88691..89728 [in whole cluster]
88691..89728 [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Producthypothetical protein
Product (GenBank)putative hydrolase or acyltransferase
Gene
Gene (GenBank)tmn17
EC number
Keyword
  • glyceroyl-CoA
Note
Note (GenBank)
  • alpha/beta-hydrolase superfamily
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
B3TMQ0
PmId
[17985890] Elucidation of the kijanimicin gene cluster: insights into the biosynthesis of spirotetronate antibiotics and nitrosugars. (J Am Chem Soc. , 2007)
ACC
B5L6L6
PmId
[18586939] Cloning and characterization of the tetrocarcin A gene cluster from Micromonospora chalcea NRRL 11289 reveals a highly conserved strategy for tetronate biosynthesis in spirotetronate antibiotics. (J Bacteriol. , 2008)
ACC
Q0R4L5
NITE
Chth_00390
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [putative hydrolase or acyltransferase]
MNDVTELKEFARVHAKALQLPAERYDEVLAGITSDEDGAPGSWTAQWSAMAGELEDAGEL
LPAFLCYTLARFPVVDGPARQAAYQKCRSVFDRWRAGQPDIQRVTASPAGREVVAWAGGL
SAAEPKPVLMVAGGIVSLKEQWAPVTLQAAALGMAIVVTELPGVGENTLPYDREGWRMLP
ALLDAVADRADVSDTYALANSFGGHLALRWAGHDARVRGIVSSGAPVSGFFGDADWLRGV
PGITRHTLARLAGAPEGDDDALHKKIADWALTPAELAGLEIPVRYSTSLRDEIIPAGEAA
FLQQHVKDLGLNEIDDVHGAPAHVQQTVDWTFGSLLAMRQGLAPS
selected fasta
>hypothetical protein [putative hydrolase or acyltransferase]
ATGAACGACGTCACCGAGCTCAAGGAGTTCGCGCGCGTCCACGCCAAGGCGCTGCAACTG
CCCGCCGAGCGGTACGACGAGGTGCTCGCCGGCATCACCAGCGACGAGGACGGCGCCCCC
GGCTCGTGGACGGCCCAGTGGTCGGCGATGGCCGGGGAGCTGGAGGACGCCGGAGAGCTG
CTGCCGGCGTTCCTCTGCTACACCCTGGCCCGCTTCCCCGTCGTCGACGGGCCGGCGCGG
CAGGCGGCGTACCAGAAGTGCCGGTCGGTGTTCGACCGCTGGCGCGCCGGCCAGCCGGAC
ATCCAGCGGGTGACGGCGTCGCCGGCCGGCCGCGAGGTGGTGGCCTGGGCCGGCGGGCTG
TCTGCCGCGGAGCCCAAGCCGGTGCTGATGGTGGCGGGCGGCATCGTGAGCCTCAAGGAG
CAGTGGGCGCCGGTCACGCTCCAGGCGGCGGCGCTCGGGATGGCCATCGTGGTCACCGAG
CTGCCCGGCGTGGGCGAGAACACCCTCCCGTACGACCGCGAGGGCTGGCGGATGCTGCCC
GCCCTGCTGGACGCGGTCGCGGACCGGGCGGACGTGTCCGACACGTACGCCCTCGCGAAC
AGCTTCGGCGGGCACCTGGCGCTGCGCTGGGCCGGGCACGACGCCCGGGTGCGCGGCATC
GTGTCGTCGGGTGCGCCGGTCAGCGGGTTCTTCGGCGACGCCGACTGGCTGCGCGGCGTG
CCGGGCATCACCCGGCACACGCTGGCCCGGCTGGCGGGTGCGCCCGAGGGGGACGACGAC
GCGCTGCACAAGAAGATCGCCGACTGGGCGCTGACGCCCGCGGAGCTGGCCGGGCTGGAG
ATCCCGGTCCGGTACTCGACCAGCCTGCGCGACGAGATCATCCCGGCCGGGGAAGCGGCG
TTCCTCCAGCAGCACGTGAAGGACCTCGGCCTGAACGAGATCGACGACGTGCACGGCGCT
CCGGCGCACGTGCAGCAGACCGTGGACTGGACGTTCGGCTCGCTGCTGGCGATGCGTCAG
GGCCTCGCCCCCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-30]  0.044 Signal
Eukaryota   
TMHMM No significant hit