close all open/close all

CDS information : Tetrn_00240


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction90,184 / 90,954 / + [in whole cluster]
90,184 / 90,954 / + [in contig]
Location90184..90954 [in whole cluster]
90184..90954 [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative pathway specific activator
Gene
Gene (GenBank)tmn18
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • 55% identity with protein_id: AAO65809.1 - MonRI from Streptomyces cinnamonensis
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q846W3
NITE
Monen_00280
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative pathway specific activator]
MQYEILGPVRVVDNRGSRFVSAKKMQVLLVLLLIRARQVVSIDEAIAEIWGQNPPRRATA
GIHVYISQLRKFLGEPGSRNNPILTRPPGYLLHLEDDEFDVDRFQELLHRGRLHLKEGRP
EQAVVAFEDGLSLWRGPVLGDLCDGPIIAGFATWLEETRLEYLEWLMEARLSLGLHRELI
GRLSALTAEYPLRETFYRQLMLALCRSERQADALRTYQQARNRLNEELGLEPCRALRDLQ
QAILVADERLELPAAV
selected fasta
>putative transcriptional regulator [putative pathway specific activator]
GTGCAGTACGAAATACTCGGACCCGTCCGGGTCGTGGACAACCGCGGCAGCAGATTCGTG
AGCGCCAAGAAGATGCAGGTGCTTCTCGTCCTGTTACTGATTCGCGCCCGGCAGGTGGTC
TCGATCGATGAGGCCATAGCCGAGATCTGGGGGCAGAACCCGCCTCGCCGAGCGACCGCG
GGCATCCACGTCTACATCTCGCAGCTCCGCAAGTTCCTCGGCGAGCCCGGCAGCCGGAAC
AACCCGATCCTCACCCGCCCACCCGGCTACCTCCTGCACCTGGAGGACGACGAGTTCGAC
GTGGACCGCTTCCAGGAGCTGCTGCACCGGGGGCGGCTGCACCTGAAGGAGGGCCGGCCC
GAGCAGGCCGTGGTCGCCTTCGAGGACGGGTTGTCCCTGTGGCGCGGTCCGGTCCTCGGG
GACCTCTGCGACGGGCCGATCATCGCGGGCTTCGCCACGTGGCTCGAGGAGACCCGGCTG
GAGTACCTGGAGTGGCTGATGGAGGCGCGGTTGAGCCTCGGGCTGCACCGGGAGCTGATC
GGCCGGCTGTCCGCGCTGACTGCGGAGTACCCACTGCGGGAGACGTTCTACCGCCAGTTG
ATGCTGGCCCTGTGCCGCTCGGAGCGGCAGGCCGACGCGCTGCGTACGTACCAGCAGGCA
AGGAACCGGCTCAACGAGGAACTCGGCCTGGAGCCCTGCCGGGCGCTGCGTGATCTGCAG
CAGGCCATCCTCGTCGCCGACGAGCGGCTGGAGCTGCCCGCGGCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [22-92]  1.5e-11 PF00486
PF00486   Trans_reg_C
 [16-92]  3.89999861795218e-12 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [99-244]  8.20001307135067e-52 SM01043
SM01043   BTAD
 [99-244]  2.50000000000001e-48 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [107-222]  2.1e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-93]  1.3e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-93]  6.899999633797e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-47]  0.328 Signal
Bacteria, Gram-positive   
 [1-41]  0.353 Signal
Eukaryota   
TMHMM No significant hit