close all open/close all

CDS information : Tetrn_00250


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction95,656 / 91,130 / - [in whole cluster]
95,656 / 91,130 / - [in contig]
Locationcomplement(91130..95656) [in whole cluster]
complement(91130..95656) [in contig]
TypeCDS
Length4,527 bp (1,508 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase-related protein
Gene
Gene (GenBank)tmnDII
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
  • putative KS, ACP, and TE domains
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module


close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase-related protein]
MTDKALLRRSLEAVRSLREQVDELRARAAEPIAVVGLGCRFPGGADGPERFWELLREGRD
GVVDVPQDRWPTEGWYSSDRSEPGTSYTRRGGFLAEGAHAFDAGFFGITDAEARDMDPQH
RLLLETSWQALESAGLLSGTAAERRVGVFVGVSGSENTLLPRSPRDAGPYTATGSAISVA
AGRVAHTFGLRGPALAVDTACSSSLLAVHLAAESLRRGECDAALAGGVSAMMSPAVMVAL
CRMEALAEDGKCKVFDAAADGYVRSEGSGMVALMRASDAAALRAPVLALIRGSAVNHDGR
TSGLTVPNGRAQRELIADAVAAAGVEPRAVDYLEAHGTGTSLGDPIEVRAAADVLCAGRD
PEAPLRIGAVKSNIGHLEAAAGVAGLIKTVLALRHGEIPGGLHLNKPNPRLGVERLPVAL
CDRTATWPRRGDGRPRTAGVSSFGFSGTNVHVVLTEPDAEPPRTGGPERPAHVFALSARD
PEGLRESAARHGRWLATHPDAALADFCHTATARRGHFAHRAAFVTASREDLARRLAALAA
GEGPGPAAVRRQTAAAEAVGARDRAPAPPVAFLLDATAPAAERIAATLSATHPGFRAHLD
RCTVELRSPAAESDVPHSPGLAADVRTVACQVALVRTLADWGIAAGAVAGGAAPGDLAAA
LLSGALDAPTAGALLAARHGAAAPPAAPPQRPRTLRLLHGSDAGEAGAAEAADPGFWLHP
GTGVRPEAAAAALAAHGYDTLVHLGGPPATAADGEIRGLPGDDIWHELLGWLADRHVSGQ
DVDWSACDDGYERTRLDLPGQTFRRRTHRPDAAALEAAPAASAAGAPVGTLGLRQVASPL
AQRQYTTAVSRAVLPELADTAGVLHVGYYQELLAAAARTGTGLRLDDVRFERALTLSRGQ
ERTVHLAVGPADGDGWAEFSVHSRDAGGAPAEQPGDEGWHRHAAGRLRPDGGGAEGDAPT
EATLPEAARAEIRERCPVRFEGAEFYRQMAERGVPLGPSVEWVDEVWLGEGEVLARFRLP
TPAEAAAAAGRPDRELPVPAGMLDACVQLYALAAGPQLAERDLFMTARLGDVGFGAPAEG
TLWCHVRLTAPVGDLLVGEHLLCAEDGAAVGWGRGTEIRVISPGSGTYEAPADDVRDGAA
QQRWRGADGAAALRDLLTGMVAELLQLTPAEVPSSRPLAETGLDSLAALELRQRVRAETG
VDLPVDLLIAGPSLDEVVERLCGSVAGEGPAAPRPYDVDGRLWLPVTPQDDAAVRLFCLP
YGGRGASLYRDWPGSAPAGVEVVPVQLPGREERSDERCLVDADEAVDAVAQALKPYLDRP
FAFYGHSMGALLAYRLAHRLGAEYGELLRHLFVGAFSAPTGGENPLGARLRSVTQRLGFE
QMPEHEELARVRRTQPRLYDTALRAELGEHLAGKADVAMDGAGYSDLRVVQSYRHDPAEV
PLRVPVTAFHGAADPVVAEQDADGWRPLTAGGYELLVVPGDHFFVHGDQSGPRVLAEMAA
RLRQPVRA
selected fasta
>polyketide synthase [type I polyketide synthase-related protein]
ATGACGGACAAGGCACTGCTCAGGCGTTCCCTGGAAGCCGTACGCAGCCTGCGCGAGCAG
GTCGACGAGCTGCGCGCGCGGGCCGCGGAGCCCATCGCCGTCGTGGGCCTCGGCTGCCGC
TTCCCGGGCGGCGCGGACGGCCCGGAGCGGTTCTGGGAGCTGCTGCGCGAGGGCCGCGAC
GGCGTCGTGGACGTACCGCAGGACCGGTGGCCCACCGAGGGCTGGTACTCCTCCGACCGG
AGCGAGCCCGGCACCTCGTACACCCGCCGCGGCGGGTTCCTCGCCGAGGGCGCCCACGCG
TTCGACGCCGGGTTCTTCGGCATCACCGACGCCGAGGCCCGCGACATGGACCCGCAGCAC
CGGCTGCTGCTGGAGACGAGCTGGCAGGCGCTGGAGAGCGCAGGGCTGCTGTCGGGCACC
GCCGCGGAACGGCGCGTCGGCGTCTTCGTCGGCGTCTCCGGTTCGGAGAACACCCTGCTG
CCCCGCTCGCCGCGCGACGCGGGTCCGTACACCGCGACCGGCTCCGCGATCAGCGTCGCG
GCGGGCCGCGTGGCGCACACCTTCGGACTGCGCGGACCGGCCCTCGCCGTCGACACGGCG
TGCTCGTCGTCGCTGCTCGCGGTGCACCTGGCCGCCGAGAGCCTGCGCCGCGGCGAGTGC
GACGCCGCGCTGGCCGGCGGGGTCAGCGCCATGATGTCGCCCGCCGTGATGGTCGCGCTG
TGCCGGATGGAGGCGCTGGCCGAGGACGGCAAGTGCAAGGTCTTCGACGCCGCCGCCGAC
GGCTACGTACGCTCCGAGGGCAGCGGCATGGTCGCCCTCATGCGCGCCTCGGACGCCGCC
GCCCTGCGCGCCCCGGTCCTCGCCCTGATCCGCGGCTCCGCCGTCAACCACGACGGCCGC
ACCAGCGGCCTGACCGTGCCCAACGGCCGCGCGCAGCGGGAGCTGATCGCCGACGCCGTG
GCCGCGGCCGGGGTCGAACCGCGGGCCGTGGACTACCTGGAGGCGCACGGCACCGGCACC
TCGCTGGGCGACCCGATCGAGGTGCGCGCCGCCGCCGACGTCCTGTGCGCCGGCCGCGAC
CCCGAGGCGCCGCTGCGCATCGGCGCCGTCAAGTCCAACATCGGGCACCTGGAGGCCGCC
GCCGGAGTGGCGGGCCTCATCAAGACCGTGCTCGCGCTGCGCCACGGCGAGATCCCCGGC
GGGCTGCACCTGAACAAGCCCAACCCCCGCCTCGGCGTCGAGCGGCTGCCGGTGGCGCTG
TGCGACCGCACGGCGACGTGGCCGCGCCGCGGCGACGGCCGGCCGCGTACCGCGGGCGTC
AGCTCCTTCGGCTTCTCCGGCACCAACGTGCACGTCGTCCTCACCGAGCCGGACGCCGAA
CCGCCGCGTACCGGGGGGCCGGAGCGCCCGGCGCACGTCTTCGCGCTCTCCGCCCGCGAC
CCCGAGGGCCTGCGCGAGTCCGCCGCCCGGCACGGCCGGTGGCTCGCCACCCACCCCGAC
GCGGCCCTCGCCGACTTCTGCCACACCGCCACCGCGCGCCGCGGGCACTTCGCCCACCGC
GCCGCGTTCGTCACCGCCTCGCGCGAGGACCTGGCGCGCCGGCTCGCGGCGCTCGCCGCG
GGCGAGGGGCCCGGGCCGGCCGCGGTCCGGCGGCAGACCGCGGCGGCCGAGGCGGTCGGC
GCCCGCGACCGGGCGCCCGCGCCGCCGGTCGCCTTCCTCCTCGACGCCACCGCGCCCGCC
GCGGAACGCATCGCCGCGACGCTGTCCGCCACCCACCCGGGCTTCCGCGCGCACCTCGAC
CGGTGCACCGTCGAACTGCGGTCCCCGGCCGCCGAGTCGGACGTCCCGCACAGCCCGGGC
CTCGCCGCCGACGTACGCACCGTGGCCTGCCAGGTCGCGCTGGTGCGCACGCTCGCCGAC
TGGGGCATCGCCGCCGGCGCCGTCGCGGGCGGCGCCGCACCGGGGGACCTCGCCGCCGCC
CTCCTCAGCGGCGCCCTCGACGCCCCCACCGCCGGCGCCCTGCTCGCCGCCCGCCACGGC
GCCGCGGCCCCGCCGGCCGCGCCGCCGCAGCGCCCGCGCACGCTGCGGCTGCTGCACGGA
TCCGACGCCGGCGAGGCCGGAGCGGCGGAGGCGGCCGACCCCGGGTTCTGGCTGCACCCC
GGCACCGGCGTACGGCCGGAGGCCGCCGCGGCGGCGCTCGCCGCGCACGGCTACGACACC
CTCGTCCACCTCGGCGGCCCCCCGGCGACGGCCGCCGACGGCGAGATCCGGGGGCTGCCC
GGCGACGACATCTGGCACGAACTCCTCGGCTGGCTCGCCGACCGGCACGTCTCCGGGCAG
GACGTCGACTGGTCCGCCTGCGACGACGGCTACGAGCGGACCCGGCTCGACCTGCCGGGC
CAGACGTTCCGACGCCGTACGCACCGCCCGGACGCCGCGGCACTGGAGGCCGCTCCCGCG
GCGTCCGCGGCCGGTGCGCCCGTGGGGACCCTCGGGCTGCGGCAGGTCGCGTCCCCGCTC
GCGCAGCGGCAGTACACGACCGCCGTCAGCCGCGCCGTCCTGCCGGAACTCGCCGACACC
GCCGGTGTGCTGCACGTCGGCTACTACCAGGAGCTGCTGGCCGCCGCCGCGCGAACGGGC
ACCGGACTGCGCCTGGACGACGTACGGTTCGAGCGGGCCCTGACGCTCTCCCGCGGCCAG
GAGCGCACCGTGCACCTGGCCGTCGGCCCCGCGGACGGCGACGGCTGGGCGGAGTTCTCC
GTACACAGCCGGGACGCCGGCGGCGCGCCCGCGGAGCAGCCGGGCGACGAGGGCTGGCAC
CGGCACGCCGCCGGCCGGCTGCGCCCCGACGGCGGCGGAGCGGAGGGCGACGCGCCGACC
GAGGCGACACTGCCCGAGGCGGCGCGGGCGGAGATCCGCGAGCGCTGCCCCGTACGCTTC
GAAGGCGCCGAGTTCTACCGGCAGATGGCCGAACGCGGCGTGCCCCTGGGCCCGTCCGTC
GAGTGGGTCGACGAGGTGTGGCTCGGCGAGGGCGAGGTGCTGGCGAGGTTCCGCCTGCCG
ACGCCCGCCGAGGCGGCCGCCGCCGCCGGCCGCCCGGACCGCGAACTCCCCGTGCCCGCC
GGCATGCTGGACGCCTGCGTCCAGCTCTACGCACTCGCCGCCGGCCCGCAGCTCGCCGAG
CGGGACTTGTTCATGACCGCCCGCCTCGGCGACGTCGGCTTCGGAGCCCCCGCGGAGGGC
ACCCTGTGGTGCCACGTGCGGCTGACCGCGCCGGTAGGCGACCTGCTGGTGGGCGAGCAC
CTGCTGTGCGCCGAGGACGGCGCGGCGGTCGGCTGGGGCCGCGGCACCGAGATCCGCGTC
ATCAGCCCGGGCTCCGGCACGTACGAGGCACCCGCCGACGACGTACGCGACGGTGCCGCT
CAGCAGCGCTGGCGCGGCGCGGACGGCGCCGCCGCGCTGCGGGACCTGCTCACCGGGATG
GTCGCGGAGCTGCTGCAGCTGACTCCCGCCGAGGTGCCGAGCAGCCGCCCGCTCGCCGAG
ACGGGCCTCGACTCCCTCGCCGCCCTGGAGCTGCGCCAGCGGGTACGCGCCGAGACCGGC
GTCGACCTGCCGGTCGACCTGCTCATCGCCGGGCCGTCGCTGGACGAGGTGGTGGAGCGC
CTCTGCGGGTCCGTCGCGGGCGAGGGGCCCGCCGCACCCCGCCCGTACGACGTCGACGGC
AGGCTCTGGCTGCCCGTCACGCCGCAGGACGACGCCGCCGTGCGGCTGTTCTGCCTGCCG
TACGGCGGCCGCGGCGCCTCCCTCTACCGGGACTGGCCGGGCAGCGCGCCCGCCGGTGTC
GAGGTGGTCCCCGTGCAGCTGCCGGGCCGGGAGGAGCGCTCCGACGAGCGCTGCCTCGTC
GACGCCGACGAGGCCGTGGACGCCGTCGCGCAGGCGCTCAAGCCCTACCTGGACCGGCCG
TTCGCGTTCTACGGGCACAGCATGGGCGCCCTCCTCGCGTACCGCCTCGCCCACCGGCTG
GGCGCCGAGTACGGGGAGCTGCTGCGCCACCTGTTCGTCGGCGCCTTCAGCGCGCCGACC
GGCGGGGAGAACCCGCTCGGCGCCCGGCTGCGGTCGGTGACCCAGCGGCTCGGTTTCGAG
CAGATGCCGGAGCACGAGGAGCTGGCCCGGGTACGCCGCACGCAGCCGCGGCTCTACGAC
ACGGCGCTGCGCGCGGAGCTGGGCGAGCACCTGGCGGGCAAGGCGGACGTGGCCATGGAC
GGCGCCGGCTACTCGGACCTGCGGGTGGTGCAGAGCTACCGGCACGACCCGGCGGAGGTG
CCGCTGCGGGTGCCGGTCACCGCGTTCCACGGCGCGGCCGACCCGGTGGTCGCCGAGCAG
GACGCCGACGGGTGGCGGCCGTTGACGGCCGGCGGGTACGAGCTGCTGGTCGTGCCGGGC
GACCACTTCTTCGTCCACGGCGACCAGAGCGGGCCGCGGGTGCTGGCGGAGATGGCCGCG
CGACTGCGCCAGCCCGTACGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1255-1496]  7.5e-29 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [625-681]  2.6e-06 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1180-1195]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1152-1223]  1.4e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1157-1221]  1.2e-09 PF00550
PF00550   PP-binding
 [1153-1222]  PS50075
PS50075   ACP_DOMAIN
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [30-279]  1.99999999999999e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [287-404]  3.2e-42 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [32-291]  1e-90 G3DSA:3.40.47.10 [292-458]  1e-60 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [21-403]  2.19999900980707e-94 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [192-208]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1154-1225]  1.59999889349252e-16 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [828-1003]  9.69999663390112e-14 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [32-459]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit