close all open/close all

CDS information : Tetrn_00260


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction103,154 / 95,688 / - [in whole cluster]
103,154 / 95,688 / - [in contig]
Locationcomplement(95688..103154) [in whole cluster]
complement(95688..103154) [in contig]
TypeCDS
Length7,467 bp (2,488 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase-related protein
Gene
Gene (GenBank)tmnDI
EC number
Keyword
Note
  • This ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
  • putative AT, ACP, KS, ACP, KS, ACP, and KR domains
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionPKS/NRPS Module


close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase-related protein]
MFALAFPGQGSQHKGMGAQLFGRFPEETARADEILGYSIEELCRDDVDGRLQNTEYTQPA
LFVVNALSHLAHRADGGAEPDYLAGHSLGEYNALHAAGAFDFATGLRLVAKRGELMSRVA
DGGMAAVVGLTADQVAELLGRPGLENLSIANYNNPTQTVVAGPREDVAGARAVFEEAGAG
LFTVLRVSGAFHSPYMSAIQGEFAEFLGGCTLAPPAVPVISNVTALPYEDDVAAALVRQL
DHPVRWTDTVRYLIAQGVADIKPVGPGRAMRGLIKATRRDEERRAQEAAEAQEARAAQEA
AAGRTPAAADDGELRLRRPERDRARPEGTPAVQLHQALLKDLRTTVAQVLKVEPAVVRSE
TELSELGFDSIRLIEFADLLRRDLGVDLTPSVFFEHFTLEAFARHLLTEHHDLVSARYPD
AGDDTPRTVAGSAGRAQDDAPLPDPYPVAVVGLSAVLPGSADLEGFWRRLLAGDELVSPV
PEDRWRDWAGPERARRAHGAFLDEVDSFDCSFFGISPHEAELMDPHQRLFLQTVWKAVED
SGRRPDALAGSRTGLFVGALLDGHAEVLGHSTAGPQAHTATGLAHAVLPNRVSYQLDLRG
PSEAIDTACSSSLVAVHRAVRSLRAGECGLAIAGGVNLMLSPTPFECFGLAGMLAPDGRC
KTFDQSADGYVRGEGVVAVVLKPLAAAEADGDHIHAVIRGSAVGHSGRAASLTAPSPEAQ
ADVIVDAWRAAGLDPATATHVETHGTGTSLGDPIEIEGLKQAFARLYAAWGHDAPAEPHC
TIGSVKTAIGHLEAAAGLAGLVTMVQALRYGKLPALRHFEKLNPYIRLDGSPFRIGDRAG
DWSRQAAPDGPAIPRRCGVSSFGFGGSNAHVVLEEYEREPAADEAPSAPLLIPLSARTPE
ALRGYARELVRHLDLHAPAEGGADFALTALADTLQLGREPMEARLAVVAEDVDELYDALV
QFLRGEDQGDTWWSGQAAGAADLSRALLAGPEGNTYLDALATAGKTAALARLWAAGADFD
WALLRGGRPVRRTPLPTYPFERRRIRPQDLVPHVLLAPGQAQPALAAAPVPAALAAAVAP
AALPSGAGATQDDVLAHLVRLFAEELKWRPEEIDPRAGFDDLGLSSLLVEKLRRRLEEHY
GPVDSATLFTYKNLDALARHMTGRVRTLPAATAPVPAAAVLPAVLPSAAVPPAAAGAGTA
DIAIVGISGRYPKAPTLADFWDRLLAGDDCVDEIPLDRPGYRRYAELAREKFGDQWPRWG
GFLDDVDAFDPQFFHISPRDARLLDPQERLFLTTAWETLEDAGYTPASLADPELGDERGS
VGVFAGVTYNNYQMFAGGDLDEGVWRIVGSQTFSVANRISHLLNLGGPSLTLDTACSSSL
YAIHLAVAAIRRGECAMALAGGVNLSLHPSKYVMLAEAGFLAEDGRCRAFAEGGTGYVPA
EAVGAVLLKPLDRALADGDRIHAVVKGSAVNSDGRTYGYGVPNPVAQAELVRAALADAGV
DAGSIGYVEAHGTGTSLGDPIEVRGLTEAYADAAAPHRRDGRPACAIGSVKATMGHAEAA
AGIAQVTKVVLQLRHGTLVPSLLHTPELNPNLDLDSTPFAVQRASAPWERPALPGSGGAA
GPRRAGVSSFGAGGVNVHLILEEAPARPAPAAGAGRPLVFPLSARTPENLRAYAARMAAF
LRELPAEPGADDPEAPRAADVAYTLQHGREAMEHRAAFAARTLPEAAERFAHLAAGGDAD
GQVSIGRRPGRSGAAPAVPADAAPERAAALWAAGGDADWAARPTGGRRVSLPTYPFSQER
YWLEPSATNPARPTAPAVPTPVPAPRTSPEVTAAAAAPAAREADTATDLLASLAAAPASE
RHTALATRMQRTLGELLEFPPGSPPDRQRGFFELGMDSVMAVRLGNLLEEALGLVLYAGV
VFDYPSIDDLATYLLDELSLDDAPAPAAPAPAAQTPEPAPADDLQVVHYTAGWEPAAAPE
GPASWLTGPVLVFDDDGALTERVRARHTGGAPVVGVRPGEAYEVAGDGRTVRAGSGQDHA
ALLAGLDAPPVTVLHAWSDPRTALTSVFHLSQALLRQGLRAPVRLLRVHAHAEGGPDPLA
EAFGGFARSVDHENPRLVQQAVTVRTAAGEEPADALLRACEAELAADARADAEVRHDADG
RRVRRLRELPAVRAEAPAGVAVRPGGTYVITGGGGGLGLLFAEHLARQARVNLLLVGRSA
LTAERQEALERIRALGADVRYERADVADRGDVEWILAAARDRWGSVHGIVHSAGVLRDGL
LPNKNADEIDLVLAGKVDGAVHFDAATAGDDLDFFMVFSSLAALAGNPGQVDYAFASRFL
NAFSRRREELRAAGGRSGASIALVWPFWRDGGMRVDDATEGFVRRRLGLTPLENAVGVAA
FDAALHHAAPEFGVVHAERDKLQRVLRIEPPAAGAAQADAARTKAAETDPAEPSAAAATG
AGSGKSAPAKGDSTVEIELKGVLAELGL
selected fasta
>polyketide synthase [type I polyketide synthase-related protein]
ATGTTTGCGCTCGCATTCCCAGGCCAGGGTTCGCAGCACAAAGGTATGGGTGCGCAGCTC
TTCGGCAGGTTCCCGGAGGAGACCGCCCGCGCGGACGAGATTCTCGGCTACTCGATCGAG
GAGCTGTGCCGCGACGACGTCGACGGACGGCTGCAGAACACCGAGTACACGCAGCCCGCG
CTCTTCGTCGTCAACGCGCTGAGCCACCTGGCCCACCGCGCCGACGGGGGCGCCGAGCCC
GACTACCTCGCCGGGCACAGCCTGGGCGAGTACAACGCCCTGCACGCCGCCGGCGCCTTC
GACTTCGCCACCGGGCTGCGCCTGGTCGCCAAGCGCGGCGAGCTGATGTCCCGGGTGGCC
GACGGCGGCATGGCCGCGGTCGTCGGGCTGACGGCGGACCAGGTCGCCGAACTCCTGGGC
CGGCCCGGCCTGGAGAACCTGTCGATCGCCAACTACAACAACCCCACGCAGACGGTGGTC
GCCGGCCCGCGCGAGGACGTGGCGGGCGCGCGCGCCGTATTCGAGGAGGCCGGCGCCGGC
CTGTTCACCGTGCTCCGCGTCAGCGGCGCGTTCCACTCCCCGTACATGTCGGCGATCCAG
GGCGAGTTCGCCGAGTTCCTCGGCGGCTGCACGCTCGCGCCGCCCGCCGTGCCCGTCATC
TCCAACGTGACCGCCCTGCCGTACGAGGACGACGTCGCCGCCGCGCTGGTACGCCAGCTC
GACCACCCCGTGCGCTGGACCGACACCGTCCGCTACCTCATCGCGCAGGGCGTGGCGGAC
ATCAAGCCCGTCGGGCCCGGCCGGGCCATGCGCGGGCTGATCAAGGCCACCCGGCGCGAC
GAGGAGCGCCGCGCACAGGAAGCGGCGGAGGCACAGGAGGCGCGGGCCGCGCAGGAGGCG
GCCGCCGGGCGGACTCCGGCAGCGGCCGACGACGGCGAACTGCGCCTGCGCCGCCCCGAA
CGCGACCGCGCCCGCCCCGAGGGCACCCCCGCCGTCCAGCTGCACCAGGCGCTCCTGAAG
GACCTGCGCACCACCGTCGCCCAGGTGCTGAAGGTCGAGCCCGCCGTCGTCCGCAGCGAG
ACGGAGCTGAGCGAGCTGGGCTTCGACTCGATCCGGCTCATCGAGTTCGCCGACCTGCTC
CGCCGCGACCTCGGCGTCGACCTCACCCCCTCGGTGTTCTTCGAGCACTTCACCCTCGAG
GCGTTCGCGCGCCACCTGCTCACCGAGCACCACGACCTCGTCTCCGCCCGCTACCCCGAC
GCCGGCGACGACACCCCCCGCACCGTCGCCGGCAGCGCCGGGCGCGCGCAGGACGACGCC
CCGCTGCCGGACCCGTACCCCGTCGCGGTGGTCGGCCTGAGCGCCGTACTGCCGGGCTCG
GCGGACCTGGAGGGCTTCTGGCGGCGCCTCCTGGCCGGCGACGAACTCGTCTCCCCGGTG
CCCGAGGACCGCTGGCGTGACTGGGCGGGCCCGGAGCGCGCCCGCCGCGCGCACGGCGCC
TTCCTCGACGAGGTCGACTCCTTCGACTGCTCGTTCTTCGGCATCTCGCCGCACGAGGCC
GAGCTGATGGACCCGCACCAGCGCCTCTTCCTGCAGACGGTGTGGAAGGCCGTCGAGGAC
TCCGGCCGCCGCCCCGACGCCCTCGCGGGCAGCCGCACCGGCCTGTTCGTCGGGGCTCTC
CTCGATGGACACGCGGAGGTGCTGGGCCACAGCACCGCCGGCCCCCAGGCGCACACCGCC
ACCGGGCTCGCGCACGCCGTGCTGCCCAACCGGGTCTCGTACCAGCTCGACCTGCGCGGC
CCGAGCGAGGCGATCGACACCGCGTGCTCGTCCTCGCTCGTCGCCGTCCACCGCGCGGTC
CGCAGCCTGCGCGCCGGCGAGTGCGGGCTCGCCATCGCCGGCGGCGTGAACCTCATGCTC
AGCCCCACCCCGTTCGAGTGCTTCGGGCTGGCCGGGATGCTCGCCCCGGACGGCCGCTGC
AAGACCTTCGACCAGTCCGCCGACGGCTACGTGCGCGGCGAGGGAGTCGTCGCCGTCGTG
CTCAAGCCGCTGGCCGCCGCCGAGGCAGACGGCGACCACATCCACGCCGTGATCCGCGGC
AGCGCCGTCGGCCACTCCGGCCGCGCCGCGTCGCTGACCGCACCGAGCCCCGAGGCGCAG
GCCGACGTCATCGTCGACGCCTGGCGCGCCGCCGGCCTCGACCCGGCGACCGCGACCCAC
GTGGAGACCCACGGCACCGGCACCAGCCTCGGCGACCCCATCGAGATCGAGGGCCTGAAG
CAGGCGTTCGCCCGCCTCTACGCCGCCTGGGGCCACGACGCCCCCGCCGAGCCGCACTGC
ACGATCGGCTCGGTCAAGACCGCCATCGGGCACCTGGAGGCCGCGGCCGGGCTGGCGGGG
CTGGTCACGATGGTGCAGGCGCTGCGGTACGGGAAGCTGCCCGCGCTGCGCCACTTCGAG
AAGCTCAACCCGTACATCCGCCTGGACGGCAGCCCCTTCCGTATCGGTGACCGCGCCGGC
GACTGGTCCCGGCAGGCCGCGCCGGACGGCCCCGCCATCCCCCGCCGCTGCGGCGTCAGC
TCCTTCGGCTTCGGCGGCAGCAACGCGCACGTCGTACTGGAGGAGTACGAGCGCGAGCCC
GCCGCGGACGAGGCGCCGAGCGCCCCGCTGCTGATCCCGCTCTCCGCCCGTACGCCCGAG
GCGCTGCGCGGCTACGCCCGCGAGCTGGTCCGCCACCTCGACCTGCACGCGCCCGCCGAG
GGCGGCGCCGACTTCGCGCTCACCGCACTCGCCGACACCCTCCAGCTCGGCCGGGAGCCG
ATGGAGGCGCGGCTCGCGGTCGTCGCCGAGGACGTCGACGAACTGTACGACGCGCTCGTG
CAGTTCCTGCGCGGCGAGGACCAGGGCGACACCTGGTGGAGCGGGCAGGCCGCGGGCGCC
GCGGACCTCTCGCGCGCGCTGCTCGCCGGCCCCGAGGGCAACACCTACCTCGACGCGCTC
GCCACCGCCGGCAAGACCGCGGCCCTGGCCCGGCTCTGGGCGGCCGGCGCGGACTTCGAC
TGGGCGCTGCTGCGCGGCGGCAGGCCCGTACGCCGCACGCCCCTGCCGACGTACCCCTTC
GAGCGCCGCCGGATCCGCCCGCAGGACCTCGTCCCGCACGTCCTGCTCGCCCCCGGCCAG
GCACAGCCGGCCCTCGCCGCCGCGCCGGTGCCCGCGGCCCTGGCCGCCGCCGTGGCGCCG
GCCGCGCTGCCCAGCGGTGCGGGCGCCACGCAGGACGACGTACTGGCGCACCTGGTGCGG
CTGTTCGCCGAGGAGCTGAAGTGGCGGCCCGAGGAGATCGACCCGCGGGCCGGCTTCGAC
GACCTGGGCCTCAGCTCGCTGCTGGTGGAGAAGCTGCGCCGGCGGCTGGAGGAGCACTAC
GGGCCGGTCGACAGCGCCACGCTCTTCACGTACAAGAACCTCGACGCGCTCGCCCGCCAC
ATGACCGGCCGGGTACGCACCCTGCCCGCGGCGACGGCGCCCGTACCGGCGGCCGCCGTC
CTGCCCGCAGTCCTCCCGTCTGCCGCCGTCCCGCCCGCAGCCGCGGGTGCCGGCACCGCG
GACATCGCCATCGTCGGCATCAGCGGCCGCTACCCCAAAGCCCCCACGCTGGCCGACTTC
TGGGACCGGCTGCTGGCCGGCGACGACTGCGTGGACGAGATACCCCTCGACCGCCCCGGC
TACCGCCGCTACGCGGAGCTGGCGCGCGAGAAGTTCGGCGACCAGTGGCCCCGCTGGGGC
GGCTTCCTGGACGACGTGGACGCCTTCGACCCGCAGTTCTTCCACATCTCGCCGCGCGAC
GCCCGGCTGCTCGACCCGCAGGAGCGGCTCTTCCTCACCACCGCGTGGGAGACGCTGGAG
GACGCCGGCTACACCCCCGCCTCGCTGGCGGACCCCGAACTCGGCGACGAGCGCGGTTCG
GTGGGCGTCTTCGCCGGGGTGACGTACAACAACTACCAGATGTTCGCGGGCGGCGACCTC
GACGAGGGCGTCTGGCGCATCGTCGGCTCGCAGACCTTCTCCGTCGCCAACCGCATCTCC
CACCTGCTCAACCTCGGCGGCCCCAGCCTGACCCTGGACACCGCCTGCTCCTCCTCCCTC
TACGCCATCCACCTGGCCGTCGCCGCCATCCGCCGCGGCGAGTGCGCCATGGCGCTGGCC
GGCGGGGTGAACCTGTCGCTGCACCCGAGCAAGTACGTGATGCTCGCCGAGGCCGGGTTC
CTCGCCGAGGACGGCCGGTGCCGCGCCTTCGCCGAGGGCGGCACCGGCTACGTACCGGCC
GAGGCGGTCGGCGCGGTGCTCCTCAAGCCGCTGGACCGGGCGCTGGCCGACGGGGACCGG
ATCCACGCCGTCGTCAAGGGCTCGGCGGTCAACAGCGACGGCCGCACCTACGGTTACGGC
GTCCCCAACCCCGTCGCACAGGCCGAGCTGGTCCGCGCCGCACTCGCCGACGCCGGTGTC
GACGCCGGCTCCATCGGCTACGTCGAGGCGCACGGCACCGGCACCAGCCTCGGCGACCCC
ATCGAGGTCCGCGGCCTCACCGAGGCGTACGCGGACGCCGCCGCCCCGCACCGCCGCGAC
GGGCGGCCGGCGTGCGCCATCGGCTCGGTGAAGGCCACCATGGGCCACGCCGAGGCGGCG
GCCGGCATCGCCCAGGTCACCAAGGTCGTCCTGCAACTGCGCCACGGTACGCTCGTGCCC
TCGCTGCTGCACACCCCCGAACTCAACCCGAACCTCGACCTCGACAGCACGCCGTTCGCC
GTGCAGCGCGCGTCCGCGCCCTGGGAGCGGCCGGCACTGCCCGGCTCCGGCGGCGCGGCC
GGTCCGCGCCGCGCCGGGGTCAGCTCCTTCGGCGCGGGCGGCGTCAACGTCCACCTGATC
CTGGAGGAGGCCCCGGCCCGGCCCGCCCCGGCCGCCGGCGCCGGCCGGCCGCTGGTGTTC
CCGCTGTCGGCCCGTACGCCGGAGAACCTGCGCGCGTACGCGGCCCGCATGGCGGCGTTC
CTGCGGGAGCTGCCCGCCGAGCCCGGCGCCGACGACCCGGAGGCGCCGCGCGCCGCCGAC
GTCGCGTACACCCTGCAGCACGGCAGGGAGGCGATGGAGCACCGCGCCGCGTTCGCGGCC
CGCACCCTCCCCGAGGCCGCCGAGCGCTTCGCACACCTGGCCGCCGGCGGCGACGCGGAC
GGGCAGGTCAGCATCGGCCGCCGCCCCGGCCGCTCCGGCGCCGCCCCCGCGGTGCCCGCC
GACGCCGCGCCGGAGCGGGCCGCCGCGCTGTGGGCCGCGGGCGGCGACGCGGACTGGGCG
GCCCGGCCCACCGGGGGCCGCCGGGTCTCGCTGCCGACGTACCCCTTCTCCCAGGAGCGC
TACTGGCTGGAGCCGAGCGCCACGAACCCGGCACGGCCGACCGCACCGGCCGTGCCGACC
CCCGTCCCCGCGCCGCGGACCTCCCCGGAGGTGACGGCCGCCGCGGCGGCTCCCGCGGCG
CGGGAGGCGGACACCGCGACGGACCTGCTCGCGTCGCTGGCCGCCGCCCCCGCGAGCGAA
CGCCACACCGCGCTGGCCACGCGGATGCAGCGCACGCTCGGCGAGCTGCTGGAGTTCCCG
CCCGGCAGCCCGCCGGACCGGCAGCGCGGCTTCTTCGAGCTGGGCATGGACTCGGTGATG
GCCGTACGCCTCGGCAACCTGCTCGAAGAGGCGCTGGGCCTCGTCCTGTACGCCGGGGTG
GTCTTCGACTACCCGAGCATCGACGACCTCGCCACGTACCTGCTGGACGAGTTGAGCCTC
GACGACGCCCCCGCCCCGGCCGCCCCCGCGCCCGCCGCGCAGACGCCGGAGCCCGCGCCG
GCCGACGACCTCCAGGTCGTGCACTACACCGCGGGCTGGGAGCCGGCCGCCGCCCCGGAG
GGCCCCGCCTCCTGGCTCACCGGCCCCGTGCTGGTCTTCGACGACGACGGCGCCCTCACC
GAGCGCGTACGCGCCCGGCACACCGGCGGCGCACCCGTCGTCGGCGTCCGCCCCGGCGAG
GCGTACGAGGTGGCCGGCGACGGCCGTACCGTACGGGCCGGGTCCGGACAGGACCACGCC
GCGCTCCTCGCCGGCCTCGACGCCCCGCCCGTGACCGTCCTGCACGCCTGGAGCGACCCG
CGCACCGCGCTCACCTCGGTCTTCCACCTCAGCCAGGCGCTCCTGCGGCAGGGACTGCGC
GCACCCGTGAGGCTGCTGCGCGTGCACGCCCACGCCGAGGGCGGACCCGATCCCCTCGCG
GAGGCGTTCGGCGGCTTCGCCCGCAGCGTCGACCACGAGAACCCGCGGCTCGTCCAGCAG
GCCGTGACCGTACGCACCGCCGCCGGCGAGGAGCCCGCGGACGCCCTGCTGCGCGCCTGC
GAGGCCGAACTCGCCGCGGACGCCCGCGCCGACGCCGAGGTGCGCCACGACGCGGACGGC
CGCCGGGTGCGCAGGCTCCGCGAGCTGCCCGCGGTACGCGCCGAGGCGCCGGCCGGCGTC
GCGGTCCGGCCGGGCGGCACGTACGTGATCACCGGCGGCGGAGGCGGCCTCGGCCTGCTC
TTCGCCGAACACCTCGCCCGCCAGGCGCGGGTGAACCTGCTCCTCGTCGGCCGTTCCGCA
CTCACCGCGGAACGCCAGGAGGCGCTGGAGCGGATCCGCGCCCTCGGCGCCGACGTCCGC
TACGAGCGTGCCGACGTCGCCGACCGCGGCGACGTCGAATGGATCCTGGCCGCCGCCCGC
GACCGCTGGGGCAGCGTGCACGGCATCGTCCACTCCGCCGGCGTGCTGCGCGACGGGCTG
CTGCCCAACAAGAACGCCGACGAGATCGACCTGGTCCTCGCGGGCAAGGTCGACGGCGCC
GTCCACTTCGACGCGGCGACCGCGGGCGACGACCTGGACTTCTTCATGGTCTTCTCCTCG
CTGGCCGCGCTCGCGGGCAACCCGGGCCAGGTCGACTACGCCTTCGCCAGCCGCTTCCTG
AACGCCTTCAGCCGCCGCCGCGAGGAACTGCGCGCCGCGGGCGGGCGGTCCGGCGCGAGC
ATCGCGCTGGTCTGGCCGTTCTGGCGCGACGGCGGCATGCGCGTCGACGACGCCACGGAA
GGCTTCGTGCGCCGCCGGCTGGGGCTGACGCCGCTGGAGAACGCGGTCGGCGTGGCGGCG
TTCGACGCGGCACTGCACCACGCCGCGCCGGAGTTCGGCGTGGTGCACGCCGAACGGGAC
AAGCTGCAGCGGGTGCTGCGGATCGAGCCGCCGGCGGCCGGGGCCGCGCAGGCGGACGCC
GCGCGGACGAAGGCAGCGGAGACGGACCCCGCGGAGCCGTCCGCCGCGGCGGCCACCGGG
GCTGGCAGCGGCAAGTCCGCCCCGGCGAAGGGCGATTCGACGGTCGAGATCGAGCTGAAG
GGCGTCCTGGCCGAGCTGGGGCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [3-116]  1.40000000000001e-58 G3DSA:3.40.366.10 [188-286]  1.40000000000001e-58 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR004410 Malonyl CoA-acyl carrier protein transacylase, FabD-type (Family)
 [1-279]  5.00000000000001e-93 TIGR00128
TIGR00128   FabD
IPR006162 Phosphopantetheine attachment site (PTM)
 [1893-1908]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [331-462]  1.50000306971104e-17 SSF47336 [1087-1216]  2.19999900980708e-18 SSF47336 [1858-1973]  1.39999892049878e-18 SSF47336
SSF47336   ACP_like
 [341-406]  1.7e-12 PF00550 [1098-1161]  3.4e-09 PF00550 [1872-1934]  1.4e-09 PF00550
PF00550   PP-binding
 [336-410]  2.1e-44 G3DSA:1.10.1200.10 [1091-1164]  2.1e-44 G3DSA:1.10.1200.10 [1854-1937]  7.59999999999998e-40 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [338-407]  PS50075 [1094-1162]  PS50075 [1865-1935]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [2186-2370]  4.6e-52 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [447-687]  1.99999999999999e-78 PF00109 [1201-1454]  1.5e-75 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [695-820]  9.50000000000005e-35 PF02801 [1462-1582]  1.29999999999998e-36 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [6-258]  3.80000000000003e-37 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [2-296]  1.40000506907309e-56 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [120-188]  3.89999861795218e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [447-698]  G3DSA:3.40.47.10 [699-879]  8.19999999999987e-111 G3DSA:3.40.47.10 [1201-1465]  G3DSA:3.40.47.10 [1466-1646]  8.19999999999987e-111 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [438-878]  5.79999653854781e-85 SSF53901 [1199-1646]  2.99998750445706e-85 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2185-2373]  2.29999999999998e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [600-616]  PS00606 [1367-1383]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [339-410]  8.69999350765688e-16 SM00823 [1095-1165]  1.89999859865864e-10 SM00823 [1866-1938]  6.30000946287306e-21 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [448-878]  SM00825 [1202-1646]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2186-2371]  1.3000049540733e-47 SM00822
SM00822   PKS_KR
SignalP
 [1-31]  0.108 Signal
Bacteria, Gram-negative   
 [1-31]  0.149 Signal
Bacteria, Gram-positive   
 [1-31]  0.121 Signal
Eukaryota   
TMHMM No significant hit