close all open/close all

CDS information : Tetrn_00270


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction103,414 / 105,168 / + [in whole cluster]
103,414 / 105,168 / + [in contig]
Location103414..105168 [in whole cluster]
103414..105168 [in contig]
TypeCDS
Length1,755 bp (584 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductAMP-binding family protein
Product (GenBank)putative acyltransferase family protein
Gene
Gene (GenBank)tmn20
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Family/Domain
FD
IPR000873

close this sectionSequence

selected fasta
>AMP-binding family protein [putative acyltransferase family protein]
MTIAVSTEEIHGDRAGFQPETDPAPVAMTPAATIGAALLDLADSDPDRPLAYVEGSGDPV
RLTAAELAERAGAAATTLAEHGVRRGDRVGVCMDTSADAYATLHGCFLLGAIPFVSEPPL
ATMRRQRWADRLRLLISRAEPRAVVVAPEFLDAVTEPCKEAGVAIVEPPFEGGLDLATAQ
AKPDDIALLQFTSGTTGDSRGVTLTHESIFANATAIGERAYRAGDLIVSWLPMHHDMGLI
GLNLAPLLHGLPVASMPPLSFAVRPERWLWAMHRYRGTFTSAPNFAYRMCASNIPDAKLA
GLDLSAWRVAGNGAEVVQANTLRLFAERMAAYGYRERSMMPCYGMAEITLAATMCEPGEP
LTTLTVSRDRLAADGEVVEAEAGAADAQELVSSGTALTGMDLRVVDDEGADLPDRRQGTI
LLRTDSMMSGYYRQPEETAKVLADDGWLNTGDQGFTDAGQTYVTGRIKDVVIIAGSNYHP
YAFESAAASVEGLRANSIAAVGCPDEERSTEALVLVVESKSHADADAVAQIREGVIQAVS
AETGLRPDRVEVVPRGTLPKTPSGKLQRRHVVDALVDGTLPTSH
selected fasta
>AMP-binding family protein [putative acyltransferase family protein]
ATGACAATTGCCGTTTCGACCGAGGAAATCCACGGCGACCGCGCGGGATTTCAGCCCGAG
ACGGACCCGGCACCGGTCGCGATGACGCCGGCCGCCACGATAGGCGCCGCACTGCTCGAC
CTGGCGGACAGCGACCCCGACCGCCCGCTCGCGTACGTCGAGGGCTCCGGCGACCCCGTG
CGGCTGACGGCGGCGGAGCTGGCGGAGCGCGCGGGCGCCGCCGCGACGACCCTCGCGGAG
CACGGCGTACGGCGCGGAGACCGCGTCGGCGTCTGCATGGACACCAGCGCCGACGCGTAC
GCCACGCTGCACGGCTGCTTCCTGCTGGGCGCCATCCCGTTCGTCAGCGAGCCGCCGCTG
GCGACGATGCGCCGGCAGCGCTGGGCCGACCGGCTGCGGCTGCTGATCAGCCGCGCGGAG
CCGCGCGCCGTGGTCGTCGCGCCGGAGTTCCTCGACGCGGTGACGGAGCCGTGCAAGGAG
GCGGGCGTCGCGATCGTCGAGCCGCCGTTCGAGGGCGGCCTCGACCTCGCCACCGCGCAG
GCCAAGCCCGACGACATCGCACTGCTGCAGTTCACCTCGGGCACCACGGGCGACAGCCGG
GGCGTGACCCTGACGCACGAGTCGATCTTCGCGAACGCCACGGCCATCGGCGAGCGCGCG
TACCGCGCCGGCGACCTGATCGTGAGCTGGCTGCCGATGCACCACGACATGGGCCTGATC
GGGCTGAACCTCGCGCCGCTGCTGCACGGACTGCCGGTGGCCAGCATGCCCCCGCTGTCC
TTCGCGGTACGGCCCGAGCGGTGGCTGTGGGCGATGCACCGCTACCGCGGGACGTTCACC
TCGGCGCCCAACTTCGCGTACCGCATGTGCGCCTCGAACATCCCCGACGCCAAGCTGGCC
GGCCTCGACCTGAGCGCCTGGCGGGTCGCCGGCAACGGCGCGGAGGTCGTGCAGGCGAAC
ACCCTGCGCCTGTTCGCCGAGCGCATGGCCGCGTACGGCTACCGCGAGCGTTCGATGATG
CCCTGCTACGGCATGGCGGAGATCACCCTGGCCGCGACGATGTGCGAGCCCGGCGAGCCG
CTGACCACGCTCACCGTCAGCCGGGACCGGCTGGCCGCGGACGGCGAGGTCGTGGAGGCC
GAGGCCGGCGCCGCCGACGCGCAGGAACTGGTGTCCTCCGGCACCGCGCTGACGGGCATG
GATCTGCGCGTCGTGGACGACGAGGGCGCCGACCTGCCGGACCGCAGGCAGGGCACCATC
CTGCTGCGCACCGACTCGATGATGTCCGGCTACTACCGCCAGCCCGAGGAGACCGCGAAG
GTCCTGGCCGACGACGGCTGGCTGAACACCGGCGACCAGGGCTTCACCGACGCCGGGCAG
ACCTACGTCACCGGCCGCATCAAGGACGTCGTCATCATCGCCGGGTCCAACTACCACCCG
TACGCCTTCGAGTCGGCCGCCGCCTCGGTGGAGGGCCTGCGGGCGAACTCCATCGCCGCG
GTCGGCTGCCCCGACGAGGAGCGCAGCACGGAGGCGCTGGTGCTGGTGGTCGAGTCGAAG
AGCCACGCGGACGCCGACGCCGTCGCCCAGATCCGCGAGGGCGTCATCCAGGCCGTCTCC
GCCGAGACCGGGCTGCGTCCCGACCGGGTGGAGGTGGTGCCGCGGGGCACGCTGCCGAAG
ACCCCGAGCGGCAAGCTCCAGCGGCGCCACGTGGTGGACGCGCTCGTCGACGGCACGCTG
CCGACGAGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [63-494]  1.79999999999997e-83 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [189-200]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [546-570]  2.1e-06 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit