close all open/close all

CDS information : Tetrn_00280


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction105,907 / 105,209 / - [in whole cluster]
105,907 / 105,209 / - [in contig]
Locationcomplement(105209..105907) [in whole cluster]
complement(105209..105907) [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative TetR-family transcriptional regulator
Gene
Gene (GenBank)tmn21
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcriptional regulator]
MARHDVPGDRPAEQPPDAGRDRRELIRLAAVELFARHGYRGTTVRAIAERAGVDPALVMY
HYGSKENVFSTVIRETMRAEELLPELPRLLDEVADTDSADDPAADGTCPGGPGSRLLRGF
LTRWEDAATRPSLLVVFRSAMEHPEASQLFREVAGGELLLPLARRIPAPDPELRAALVAS
LLVGLVTGRYVVPIEPLAGMELDTVVGLYGPYADDMLLGRLGGSPPPGRPGA
selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcriptional regulator]
ATGGCGCGGCACGACGTGCCCGGCGACCGGCCGGCGGAGCAGCCGCCGGACGCCGGGCGG
GACCGCCGCGAGCTGATACGGCTCGCGGCGGTCGAGCTGTTCGCCCGCCACGGCTACCGC
GGCACCACCGTGCGGGCCATTGCCGAACGCGCCGGGGTGGACCCGGCGCTGGTGATGTAC
CACTACGGCAGCAAGGAGAACGTCTTCTCCACGGTGATCCGCGAGACGATGCGCGCCGAG
GAGCTGCTGCCCGAGCTGCCCCGGCTGCTCGACGAGGTCGCCGACACCGACAGCGCAGAC
GACCCCGCCGCGGACGGCACCTGCCCCGGCGGGCCCGGCAGCCGGCTGCTGCGCGGCTTC
CTCACCCGCTGGGAGGACGCCGCCACCCGCCCCTCGCTGCTCGTGGTCTTCCGCTCCGCG
ATGGAGCACCCCGAGGCGTCGCAGCTCTTCCGCGAGGTCGCCGGCGGCGAACTGCTGCTG
CCCCTGGCGCGGCGCATCCCGGCCCCCGACCCCGAGCTGCGCGCAGCGCTGGTCGCCTCG
CTGCTCGTCGGGCTGGTCACCGGACGCTACGTCGTGCCCATCGAACCGCTGGCCGGGATG
GAGCTGGACACCGTCGTCGGGCTCTACGGCCCGTACGCGGACGACATGCTGCTCGGCCGG
CTGGGCGGCTCCCCGCCGCCCGGCCGGCCTGGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [28-71]  5.10000000000001e-15 PF00440
PF00440   TetR_N
 [26-39]  3.6000003870074e-07 PR00455 [47-70]  3.6000003870074e-07 PR00455
PR00455   HTHTETR
 [20-80]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [10-93]  1.80000149287196e-15 SSF46689
SSF46689   Homeodomain_like
 [17-70]  2.4e-19 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [109-220]  3.69999438558106e-31 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [106-219]  6.29999999999998e-38 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit