close all open/close all

CDS information : Tetrn_00290


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction107,010 / 105,907 / - [in whole cluster]
107,010 / 105,907 / - [in contig]
Locationcomplement(105907..107010) [in whole cluster]
complement(105907..107010) [in contig]
TypeCDS
Length1,104 bp (367 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)tmn22
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative membrane protein]
MTTPAAGSPHGAAPAPAPAPTGPPPEAGRSGTYGVLVVPAVLGLFLVLAFAGLMIPGLRS
PAPTDMPLGLAGPGPTVQQVEAQLAAAAPDAFEVKRYADEAEARTALREQDVLGAIVIGP
SPKQPPGLLIASAAGDAPTTAATTAYEQLTKQLGTPQQVDDVAPLPENDTRGVSAVLLCV
ALTIGALIFQLVLSLAAAHVGAAKRWLSCFCYAVVAGAAGALFAGPVTGTLDGHFLELLG
IATLLSLTVVGIVAACQALLGALGIAVGALLVLPLGLASSGGVVDPHFQPAFYGAVSEYL
PTGSAVSLLRRVLYFDGNAVGGPLLTLLLWAAGAWLVTLVSERIRPFQPLMVIVPASAVG
PAAARTA
selected fasta
>hypothetical protein [putative membrane protein]
GTGACCACACCGGCCGCAGGGTCCCCCCACGGCGCGGCGCCGGCGCCGGCCCCGGCACCG
ACCGGACCGCCCCCGGAAGCCGGCCGCTCCGGCACCTACGGCGTGCTCGTCGTCCCGGCC
GTCCTCGGGCTCTTCCTCGTCCTCGCCTTCGCCGGGCTGATGATCCCCGGACTGCGCAGC
CCCGCCCCGACCGACATGCCCCTCGGCCTGGCCGGCCCCGGCCCGACCGTCCAGCAGGTC
GAGGCGCAGCTCGCCGCCGCCGCCCCCGACGCGTTCGAGGTCAAGCGGTACGCGGACGAG
GCCGAGGCCCGCACCGCCCTGCGCGAGCAGGACGTGCTCGGCGCCATCGTCATCGGACCG
TCGCCGAAGCAGCCGCCCGGCCTGCTCATCGCGAGCGCCGCCGGCGACGCCCCGACGACC
GCGGCCACGACGGCGTACGAGCAGCTGACCAAGCAACTCGGCACCCCGCAGCAGGTGGAC
GACGTCGCCCCGCTGCCGGAGAACGACACCCGCGGCGTCAGCGCCGTGCTGCTGTGCGTC
GCCCTCACCATCGGCGCGCTGATCTTCCAGCTCGTCCTCAGCCTGGCCGCCGCCCACGTG
GGCGCCGCCAAGCGATGGCTGTCCTGCTTCTGCTACGCCGTCGTCGCCGGCGCGGCCGGA
GCCCTCTTCGCCGGACCCGTCACCGGCACCCTCGACGGCCACTTCCTCGAACTGCTGGGC
ATCGCCACCCTGCTGTCGCTGACCGTCGTCGGCATCGTCGCCGCCTGCCAGGCGCTCCTG
GGCGCGCTCGGCATCGCCGTCGGCGCGCTGCTCGTCCTCCCGCTCGGCCTCGCCTCCTCC
GGCGGCGTCGTCGACCCGCACTTCCAGCCCGCCTTCTACGGCGCCGTCTCGGAGTACCTG
CCCACGGGCAGCGCGGTCTCGCTGCTGCGCCGGGTGCTGTACTTCGACGGCAACGCGGTC
GGCGGACCGCTGCTCACGCTGCTGCTGTGGGCGGCCGGCGCCTGGCTCGTCACGCTGGTG
AGCGAGCGGATCAGGCCCTTCCAGCCGCTGATGGTCATCGTGCCCGCCTCCGCCGTGGGC
CCCGCCGCGGCCCGGACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [33-55]  Transmembrane (i-o) [172-194]  Transmembrane (o-i) [206-228]  Transmembrane (i-o) [233-255]  Transmembrane (o-i) [262-284]  Transmembrane (i-o) [319-341]  Transmembrane (o-i)
Transmembrane 6