close all open/close all

CDS information : Tetrn_00300


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction107,270 / 108,862 / + [in whole cluster]
107,270 / 108,862 / + [in contig]
Location107270..108862 [in whole cluster]
107270..108862 [in contig]
TypeCDS
Length1,593 bp (530 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase/putative phosphopantetheinyl transferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn23
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
  • bifunctional protein
Note (GenBank)
  • This protein contains two domains similar to calcineurin-like phosphoesterase and phosphopantetheinyl transferase
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)
Related Reference
ACC
Q6T709
PmId
[14695521] Identification of a phosphopantetheinyl transferase for erythromycin biosynthesis in Saccharopolyspora erythraea. (Chembiochem. , 2004)
Family/Domain
FD
IPR004843

close this sectionSequence

selected fasta
>putative hydrolase/putative phosphopantetheinyl transferase [hypothetical protein]
MSLMHGRLLAVSDLHVAYEENRDITAGLRPTAADDWLIVAGDVGERVSDIEWTLGLLAER
FAKVVWVPGNHELWTHPDDPVKLRGEERYRHLVELCRGLGVVTPEDPYPVWRGEGGPVTV
APLFVLYDYSFRMPGVATKEESLRLAHEAGVVCTDEYFLHPDPHPSRDAWCRERVALTER
RLADVDPAHPTVLINHWPLVRQPTDILRYPEFAQWCGTTLTADWHRRFRAAAVVYGHLHI
PRVTWYDGVKFSEVSLGYPREWKRRPPRDLLRPVLPPAPASAAAQAARPPAPAAAEPARL
LQQLLPDAVTAAEAFSDPPEPPAERLYPEEAQAVARAVPHRQAEFATVRQCARRALGTLG
VEPAPLLPGRRGAPQWPAGIVGSMTHCAGYRAAAVARRGDVLGVGIDAEPNEELKDGLLE
AIALPEEQELVRARMRGTSGVCWDRLLFSAKESVFKVWYPLTGRELDFDEARIDVDPADG
TFTARILVDAPTVDGTSLARLQGRWLCRSGLLVTAVSLTAGAGGRAGNGE
selected fasta
>putative hydrolase/putative phosphopantetheinyl transferase [hypothetical protein]
ATGTCCCTGATGCACGGAAGACTGCTGGCCGTCAGCGACCTGCACGTCGCCTACGAAGAG
AACCGCGACATCACCGCCGGGCTGCGCCCGACCGCGGCCGATGACTGGCTGATCGTCGCC
GGTGACGTCGGCGAGCGCGTCTCGGACATCGAATGGACCCTCGGGCTGCTCGCCGAGCGG
TTCGCCAAGGTCGTCTGGGTACCGGGCAACCACGAACTGTGGACGCACCCCGACGACCCG
GTGAAGCTGCGCGGTGAGGAGCGCTACCGGCACCTGGTCGAACTCTGCCGCGGACTGGGG
GTCGTGACCCCCGAGGACCCGTATCCCGTCTGGCGCGGCGAGGGCGGCCCCGTGACCGTC
GCGCCCCTTTTCGTGCTCTACGACTACTCCTTCCGCATGCCGGGCGTGGCGACCAAGGAG
GAGTCGCTGCGCCTGGCCCACGAGGCCGGAGTCGTCTGCACCGACGAGTACTTCCTGCAC
CCCGACCCGCACCCCTCGCGCGATGCCTGGTGCCGGGAGCGGGTGGCCCTGACCGAGCGG
CGGCTCGCGGACGTCGACCCCGCGCACCCCACGGTGCTGATCAACCACTGGCCGCTGGTG
CGGCAGCCGACCGACATCCTGCGCTACCCGGAGTTCGCGCAGTGGTGCGGTACGACGCTG
ACCGCCGACTGGCACCGCCGCTTCCGCGCGGCCGCCGTCGTCTACGGCCACCTGCACATC
CCCCGGGTCACCTGGTACGACGGCGTCAAGTTCAGCGAGGTGTCGCTCGGCTACCCGCGC
GAGTGGAAGCGCCGCCCGCCGCGCGACCTGCTGCGCCCGGTCCTGCCGCCGGCGCCGGCG
AGTGCCGCGGCGCAGGCCGCGCGGCCACCAGCGCCCGCGGCGGCCGAACCGGCCCGGCTG
CTCCAGCAGTTACTGCCCGACGCGGTGACCGCGGCGGAGGCGTTCAGCGACCCGCCGGAG
CCGCCCGCGGAGCGGCTGTACCCCGAGGAGGCGCAGGCCGTCGCCCGGGCCGTACCGCAC
CGCCAGGCGGAGTTCGCCACCGTGCGGCAGTGCGCCCGCCGCGCCCTGGGCACCCTCGGC
GTCGAGCCGGCCCCCCTGCTCCCCGGCCGCCGCGGCGCGCCGCAGTGGCCCGCCGGGATC
GTCGGCTCCATGACGCACTGCGCCGGCTACCGCGCCGCCGCCGTGGCCCGCCGCGGCGAC
GTGCTCGGTGTCGGCATCGACGCCGAGCCCAACGAGGAGCTCAAGGACGGGCTCCTGGAG
GCCATCGCGCTGCCGGAGGAGCAGGAGCTGGTGCGCGCCCGGATGCGCGGCACGTCCGGG
GTCTGCTGGGACCGGCTGCTGTTCAGCGCCAAGGAGTCGGTCTTCAAGGTCTGGTATCCG
CTGACCGGCAGGGAGCTGGACTTCGACGAGGCCCGTATCGACGTGGACCCGGCGGACGGG
ACGTTCACCGCCAGGATCCTGGTCGACGCGCCCACGGTCGACGGCACCTCCCTGGCCCGT
CTGCAGGGCCGCTGGCTGTGCCGCAGCGGGCTGCTCGTCACCGCCGTGTCGCTGACCGCG
GGAGCCGGCGGGCGCGCCGGGAACGGCGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [339-359]  4.80000830876748e-22 PR01399 [369-387]  4.80000830876748e-22 PR01399 [446-462]  4.80000830876748e-22 PR01399
PR01399   ENTSNTHTASED
IPR004843 Metallophosphoesterase domain (Domain)
 [7-241]  1.3e-14 PF00149
PF00149   Metallophos
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [401-477]  4.6e-07 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [400-520]  9.80000272130218e-14 SSF56214
SSF56214   4-PPT_transf
 [403-484]  2.3e-13 PF01648
PF01648   ACPS
SignalP No significant hit
TMHMM No significant hit