close all open/close all

CDS information : Tetrn_00310


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction108,964 / 110,211 / + [in whole cluster]
108,964 / 110,211 / + [in contig]
Location108964..110211 [in whole cluster]
108964..110211 [in contig]
TypeCDS
Length1,248 bp (415 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn24
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
  • 25% identity with protein_id: CAB92560.1 - putative carboxylase from Streptomyces coelicolor A3(2)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MGVLYDAGSACAAEVAAAARCCDAELFLVVDRASEHVRARLPVLTRRFALCDITGLAARD
AARAVSEFVPDGLLTFSEHRMEMTSAIAAAIGIPYWHSPAVAGRLVDKLQQRRAFAEAGL
DDLPFAPVADAADLDAALDAVGLPAVLKPRRGAGGRLVQRLDTVSGARAAVAACADAAPG
TDLLVEALLPGDPEAAGAQWGDYVSVETAVHRRECQPLCVTGKFPLAAPFRERGSFVPHT
LDAPLAERAETLAEAAIGALDISDGIVHTQLKLTAEGPRLVEVNGRLGSLVGDVVRRGSG
FDMVAAAMRLALGLPVPDAPRFDEVTYQYSLLPPVHGAAHAPAAGPPDLSARLDGLRHLP
GVDLAVLLDAPAPPGLQDLAAARLGRLQGRTADHAELTRLATAIDELCSPVLGTV
selected fasta
>hypothetical protein [hypothetical protein]
GTGGGCGTCCTGTACGACGCGGGCTCGGCCTGCGCCGCGGAGGTCGCGGCGGCGGCACGC
TGCTGCGACGCCGAGCTGTTCCTCGTCGTGGACCGGGCCTCGGAACACGTGCGGGCGCGG
CTGCCGGTGCTGACGCGGCGGTTCGCGCTGTGCGACATCACCGGTCTCGCCGCGCGGGAC
GCGGCGCGGGCGGTCTCCGAGTTCGTACCCGACGGGCTGCTGACGTTCAGCGAGCACCGG
ATGGAGATGACCTCCGCGATCGCCGCGGCGATCGGCATCCCGTACTGGCACTCCCCCGCG
GTCGCCGGGCGGCTGGTGGACAAGCTCCAGCAGCGCCGGGCGTTCGCCGAAGCGGGCCTG
GACGACCTGCCGTTCGCACCGGTGGCCGACGCCGCGGACCTCGACGCCGCGCTGGACGCG
GTGGGGCTGCCCGCGGTGCTGAAGCCGCGGCGCGGCGCCGGCGGCCGGCTCGTACAGCGC
CTCGACACGGTCTCCGGCGCCCGGGCGGCGGTCGCGGCGTGCGCGGACGCGGCGCCCGGC
ACGGACCTGCTGGTCGAGGCGCTGCTCCCGGGCGACCCCGAGGCGGCCGGGGCGCAGTGG
GGCGACTACGTCTCCGTGGAGACCGCCGTGCACCGCAGGGAGTGCCAACCGCTGTGCGTA
ACGGGGAAGTTCCCCCTTGCCGCGCCCTTCCGGGAGCGCGGCTCCTTCGTCCCGCACACC
CTCGACGCCCCGCTGGCGGAGCGCGCCGAGACCCTGGCGGAGGCGGCGATAGGCGCGCTG
GACATCAGCGACGGCATCGTGCACACGCAGCTGAAGCTCACCGCGGAGGGGCCGCGGCTG
GTCGAGGTCAACGGCCGCCTCGGCAGCCTCGTCGGCGACGTCGTACGGCGCGGGTCGGGC
TTCGACATGGTGGCGGCGGCGATGCGGCTGGCGCTGGGGCTGCCGGTGCCGGACGCACCG
CGGTTCGACGAGGTCACGTACCAGTACTCGCTGCTGCCGCCGGTGCACGGTGCCGCGCAC
GCGCCCGCGGCCGGCCCGCCGGACCTGTCCGCCCGGCTCGACGGGCTGCGCCACCTCCCC
GGCGTCGACCTCGCCGTCCTGCTCGACGCACCGGCACCGCCCGGCCTCCAGGACCTGGCG
GCCGCGCGCCTCGGGCGGCTCCAGGGACGTACGGCGGACCACGCGGAACTCACCCGGCTG
GCAACGGCGATCGACGAACTGTGCAGCCCGGTGCTCGGCACGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011761 ATP-grasp fold (Domain)
 [112-312]  PS50975
PS50975   ATP_GRASP
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [117-191]  3.3e-10 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [235-337]  1e-07 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
SignalP
 [1-39]  0.11 Signal
Eukaryota   
 [1-51]  0.039 Signal
Bacteria, Gram-negative   
TMHMM No significant hit