close all open/close all

CDS information : Tetrn_00320


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction110,322 / 112,313 / + [in whole cluster]
110,322 / 112,313 / + [in contig]
Location110322..112313 [in whole cluster]
110322..112313 [in contig]
TypeCDS
Length1,992 bp (663 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn25
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPTSSRPHLRDGGLPRGGTPAAAPAAPLEHYAPLARLAYLTLPPALGRHRRVLTAHTVAQ
RALPAARERRRLRVPAQRAAAVREPETDVGLDELRVRVLRSALRHAGAARRVPGWLQSGR
GLPVVLGLRMATAAGGADELSVERSLARLSAPERAAFALLTVEGLDPARTRDLLERAGVR
EPGAALRRAEGVAAAVPEAEALLRSGEFDPTAVQLRPTDLVRRRRRRRVAAALAAAVVVG
AVGAGSAILPGDGGGRGAAGAAGAGGVPAALLDPGRLVQAPPEAWADTARVDFTAWPARG
GLTGDDALLGRALSAWAAPAPDVGLTGTPGTSAAPPAAPPRLLYAGEVSGAAVVLLYEGE
RLVRYAESADGSDAPPALDVARVDDADVTTAAAVAVSRGRDGVRYLLAPWVDETATRDLL
RPDEPARDLGVADDGVTDPVPASPAEGCDAWPALRLRSSARIVEDHSFLVTDLGDLTPVH
LTYTPPPGEGAPARQPREATSGPALAGWARSACRLDGWRGEGVRAVNNWVFAQQELPEDA
GRADWVCSRAGTWRGPGRVLVQLQPPARSAATPGRVVAAESDGEDSAACSRFGRHVLAST
DWRAPSGRWYLLAAGSRDVRGIEATGDVEATAAGPTLAKRAEKGVRARVTGRIEGGGSLA
TGR
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCGACGAGCAGCCGCCCGCACCTCCGCGACGGCGGACTCCCCCGCGGCGGGACCCCC
GCCGCCGCGCCGGCGGCGCCGCTGGAGCACTACGCGCCGCTCGCCCGGCTCGCCTACCTC
ACCCTGCCGCCGGCCCTCGGCAGGCACCGGCGCGTCCTCACCGCCCACACCGTCGCGCAG
CGGGCGCTCCCCGCGGCGCGGGAGCGGCGCCGGCTGCGCGTCCCGGCGCAACGCGCGGCG
GCGGTGCGCGAGCCGGAGACGGACGTCGGGCTCGACGAACTGCGGGTGCGGGTGCTGCGG
TCGGCCCTGCGCCACGCCGGCGCGGCACGCCGCGTGCCGGGGTGGCTGCAGTCGGGGCGG
GGGCTGCCCGTCGTACTGGGGCTGCGGATGGCGACGGCGGCCGGCGGCGCCGACGAGTTG
AGCGTCGAGCGGTCGCTGGCACGGCTGTCGGCGCCGGAGCGCGCCGCCTTCGCGCTGCTG
ACGGTCGAGGGCCTGGATCCGGCCCGTACGCGGGACCTGCTGGAGCGGGCGGGCGTACGG
GAGCCGGGGGCCGCGCTGCGCAGGGCGGAGGGCGTCGCCGCCGCGGTGCCGGAGGCGGAG
GCGCTGCTGCGCTCCGGCGAGTTCGACCCCACCGCGGTGCAACTGCGGCCGACGGACCTG
GTGCGCCGGCGCCGCCGGCGGCGGGTCGCGGCGGCACTGGCGGCCGCGGTCGTCGTCGGC
GCGGTCGGCGCGGGGTCGGCGATCCTGCCCGGCGACGGAGGCGGGCGGGGCGCCGCGGGG
GCCGCGGGGGCCGGCGGCGTACCCGCCGCGCTGCTCGACCCCGGCCGCCTCGTGCAGGCA
CCGCCGGAGGCGTGGGCGGACACCGCGCGCGTGGACTTCACCGCCTGGCCCGCGCGCGGC
GGGCTGACGGGGGACGACGCGTTGCTGGGCCGGGCGCTGTCCGCGTGGGCCGCGCCGGCA
CCGGACGTGGGGCTGACCGGGACGCCGGGCACCTCGGCCGCACCGCCGGCCGCGCCGCCC
CGGCTGCTCTACGCGGGCGAGGTCTCCGGCGCCGCGGTCGTCCTGCTGTACGAGGGCGAA
CGCCTCGTGCGCTACGCCGAGTCCGCGGACGGCTCCGACGCCCCGCCCGCCCTCGACGTC
GCGCGCGTCGACGACGCCGACGTGACGACCGCCGCGGCGGTTGCGGTGAGCCGCGGCCGC
GACGGCGTCCGCTACCTCCTCGCGCCCTGGGTGGACGAGACCGCCACCCGCGACCTGCTC
CGCCCCGACGAGCCGGCGCGCGACCTGGGCGTCGCGGACGACGGGGTCACCGACCCGGTG
CCGGCGAGCCCCGCCGAGGGCTGCGACGCCTGGCCGGCGCTCCGGCTCCGGTCCTCCGCG
CGGATCGTGGAGGACCACTCGTTCCTCGTCACCGACCTCGGGGACCTCACCCCGGTCCAC
CTGACGTACACGCCGCCGCCCGGCGAGGGCGCACCGGCCCGCCAGCCGCGCGAGGCGACC
TCCGGCCCCGCCCTCGCCGGCTGGGCCCGCTCGGCCTGCCGGCTGGACGGCTGGCGCGGT
GAGGGCGTACGGGCCGTGAACAACTGGGTGTTCGCCCAGCAGGAGCTGCCCGAGGACGCC
GGCCGGGCCGACTGGGTGTGCAGCAGGGCCGGTACGTGGCGCGGGCCAGGCCGGGTCCTG
GTGCAGTTGCAGCCGCCGGCCCGCTCGGCCGCGACGCCGGGCCGCGTGGTCGCCGCGGAG
AGCGACGGGGAGGACTCGGCGGCGTGCAGCCGCTTCGGCCGGCACGTCCTCGCGTCCACC
GACTGGCGCGCCCCTTCGGGCCGTTGGTACCTGCTGGCGGCCGGCAGCCGGGACGTACGG
GGCATCGAGGCCACCGGCGACGTCGAGGCCACCGCCGCGGGACCGACGCTGGCGAAGCGG
GCGGAGAAGGGCGTACGCGCCCGGGTGACCGGCCGCATCGAGGGCGGCGGCAGCCTGGCG
ACGGGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [229-251]  Transmembrane (i-o)
Transmembrane 1