close all open/close all
Tetrn_00320 Tetrn_00320   last last

CDS information : Tetrn_00330


close this sectionLocation

Organism
StrainNRRL 11266
Entry nameTetronomycin
Contig
Start / Stop / Direction112,404 / 113,111 / + [in whole cluster]
112,404 / 113,111 / + [in contig]
Location112404..113111 [in whole cluster]
112404..113111 [in contig]
TypeCDS
Length708 bp (235 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)tmn26
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tetronomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18404760] Analysis of the tetronomycin gene cluster: insights into the biosynthesis of a polyether tetronate antibiotic. (Chembiochem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MKRTVVPVAAVAVALIGGCAGEASGCDAEYRLAEVKGEKRPVRIEPGQHHPGLNDRELEE
ALPTPEQEAATNDKVLNHLRRETVRMAGVMGETGRGRCAGEVDRPRGETVRCTVTYEGVT
VPWLVTSKGTTSGMGAFSQDFVYTAKPLKTLHTARSVYDWYAWETGKNGTTEGPLAPVDP
RCDRLPEVFTAEPGDETGYFCQDVSKTCTDDVQHVEWGDRPIRSEENGDLSFLAG
selected fasta
>hypothetical protein [hypothetical protein]
ATGAAGCGAACGGTGGTTCCGGTCGCGGCGGTCGCCGTGGCACTGATCGGCGGCTGTGCC
GGGGAGGCGAGCGGCTGCGACGCCGAGTACCGGCTCGCCGAGGTGAAGGGCGAGAAGCGG
CCGGTGCGGATCGAGCCCGGTCAGCACCACCCCGGGCTGAACGACCGCGAGTTGGAGGAG
GCCCTGCCGACGCCGGAGCAGGAAGCCGCGACGAACGACAAGGTGCTCAACCATCTGCGC
CGGGAGACCGTGCGGATGGCCGGCGTCATGGGCGAGACGGGACGCGGCCGGTGTGCGGGC
GAGGTCGACCGGCCGCGCGGCGAGACCGTCCGCTGCACGGTGACGTACGAGGGTGTGACC
GTGCCCTGGCTGGTGACGAGCAAGGGGACGACGTCGGGCATGGGCGCCTTCAGCCAGGAT
TTCGTCTATACGGCCAAGCCGCTCAAGACCCTGCACACGGCCCGGTCCGTCTACGACTGG
TACGCCTGGGAGACCGGCAAGAACGGCACGACGGAGGGCCCGCTGGCCCCGGTCGACCCG
CGGTGCGACCGGCTGCCGGAGGTCTTCACCGCCGAGCCCGGCGATGAGACCGGCTACTTC
TGCCAGGACGTCTCGAAGACCTGCACCGACGACGTCCAGCACGTGGAGTGGGGCGACCGG
CCGATCCGGTCGGAGGAGAACGGCGACCTGTCGTTCCTCGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-25]  0.982 Signal
Bacteria, Gram-positive   
 [1-21]  0.999 Signal
Eukaryota   
 [1-25]  0.984 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Tetrn_00320 Tetrn_00320   last last