close all open/close all
first first   Urd_00020 Urd_00020

CDS information : Urd_00010


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction238 / 684 / + [in whole cluster]
238 / 684 / + [in contig]
Location238..684 [in whole cluster]
238..684 [in contig]
TypeCDS
Length447 bp (148 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative HxlR family transcriptional regulator
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Urd-Orf148; uses GTG start codon
Reference
ACC
Related Reference
ACC
P42406
PmId
[10572115] Bacillus subtilis yckG and yckF encode two key enzymes of the ribulose monophosphate pathway used by methylotrophs, and yckH is required for their expression. (J Bacteriol. , 1999)
[15978081] HxlR, a member of the DUF24 protein family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis. (Mol Microbiol. , 2005)
Family/Domain
FD
IPR002577

close this sectionSequence

selected fasta
>putative HxlR family transcriptional regulator [unknown]
MTHPTVGHPAGLPDDPRADVTAPTPECPVEITLAALHGRWTTLVIRELLRGDHSYSELRA
ALPVMSDKVLSDRLAHLTRAGVVDRDRRPSWPPRVRYTLTPNGHRLGPVLQALWDWGAYG
EEPRSTGDDPVGLRELPVHPKADGAARC
selected fasta
>putative HxlR family transcriptional regulator [unknown]
GTGACTCACCCAACGGTTGGTCACCCCGCAGGACTCCCCGACGACCCGCGTGCCGACGTC
ACCGCCCCCACTCCCGAGTGCCCGGTGGAGATCACGCTGGCGGCCCTGCACGGCCGCTGG
ACGACGCTGGTGATCCGCGAACTGCTGCGAGGCGACCACTCCTACAGCGAACTCCGCGCG
GCTCTGCCCGTCATGTCGGACAAGGTGCTGTCCGACCGGCTGGCCCACCTCACCCGGGCG
GGAGTCGTCGACCGCGACCGCCGCCCGAGCTGGCCCCCACGCGTCCGCTACACCCTCACC
CCGAACGGCCACCGCCTGGGCCCGGTCCTTCAGGCCCTGTGGGACTGGGGCGCGTACGGG
GAAGAGCCTCGGTCCACAGGCGACGACCCGGTCGGGCTTCGTGAACTCCCCGTTCATCCC
AAAGCAGACGGAGCTGCACGGTGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002577 Helix-turn-helix, HxlR type (Domain)
 [27-125]  PS51118
PS51118   HTH_HXLR
 [36-119]  1.1e-23 PF01638
PF01638   HxlR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [27-106]  1.7e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit
first first   Urd_00020 Urd_00020