close all open/close all

CDS information : Urd_00020


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction1,822 / 755 / - [in whole cluster]
1,822 / 755 / - [in contig]
Locationcomplement(755..1822) [in whole cluster]
complement(755..1822) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Urd-Orf355
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MDANDLASVVTQMISGLATSVGAGVGTAAGEEVSRLVRERLGGSEEGRTALARLDEEPGS
GEAQTQLRTVLARSLADDPDFAARVEGAASRNTLHSGRDMTVQTVSVSGSTVKGTINIGP
LTITKSPGGYLALGAAVVVLALLIAFGTYGTVRVITLEDSPDTRPTGSTTTPHAGSGPRL
EPVMTKNAAKAAMPDQSALPAGWSAAGEPDVVTASEAGYPVDPGGPALSGGTELRGPDYG
ISLEMEFFETAASAAKKFNRSDILAGWDIDQHSESLEMPKTGDESLAFIDYTPSDYVTGM
VTAARIGTVVCQVASWDTAKPADHAAEVFAFTRMCVQRAEQAQQGRTPDAVVVTG
selected fasta
>hypothetical protein [unknown]
ATGGATGCGAATGACCTGGCGTCGGTCGTGACGCAGATGATCAGTGGCCTGGCAACCAGC
GTGGGCGCCGGTGTGGGGACGGCTGCCGGGGAGGAGGTGTCCAGGCTGGTCAGGGAGCGG
CTCGGCGGGTCTGAAGAGGGCCGTACGGCACTGGCGCGGCTTGATGAGGAACCTGGATCC
GGCGAAGCGCAGACCCAGCTGCGGACGGTCCTGGCGAGGTCTCTCGCCGACGATCCGGAC
TTCGCTGCGCGAGTGGAAGGCGCTGCGAGCCGGAACACGCTTCACTCGGGCAGGGACATG
ACCGTACAGACGGTCAGCGTCAGCGGCAGTACCGTAAAGGGCACCATCAACATCGGTCCG
TTGACCATCACGAAGTCCCCTGGCGGATACCTTGCTCTTGGCGCCGCCGTCGTCGTACTG
GCCTTATTAATCGCCTTTGGCACGTACGGCACGGTCCGAGTAATCACCCTCGAAGACTCA
CCGGACACGCGCCCCACCGGTTCGACCACCACGCCGCACGCCGGCAGCGGGCCCCGACTG
GAGCCGGTCATGACCAAGAATGCCGCGAAGGCGGCCATGCCGGACCAGTCCGCTCTGCCT
GCCGGCTGGTCCGCGGCCGGCGAGCCCGATGTGGTCACGGCAAGTGAGGCTGGCTATCCG
GTTGATCCGGGCGGCCCGGCGCTCTCCGGCGGCACAGAACTCAGGGGACCCGACTACGGC
ATCAGCCTGGAGATGGAGTTCTTCGAGACTGCGGCCTCGGCAGCGAAGAAGTTCAACCGC
TCCGACATCCTCGCCGGATGGGACATCGACCAGCACAGCGAGTCCCTGGAGATGCCGAAG
ACCGGTGACGAGAGCTTGGCCTTCATCGACTACACCCCCTCCGACTACGTGACGGGGATG
GTCACCGCAGCGCGGATCGGCACCGTCGTGTGCCAAGTGGCGTCGTGGGACACCGCCAAG
CCCGCAGATCACGCCGCCGAGGTCTTCGCCTTCACCCGAATGTGCGTCCAGCGCGCCGAA
CAGGCCCAGCAGGGGAGGACGCCGGACGCGGTCGTGGTGACGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  0.311 Signal
Bacteria, Gram-positive   
TMHMM
 [130-152]  Transmembrane (i-o)
Transmembrane 1