close all open/close all

CDS information : Urd_00030


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction3,332 / 4,612 / + [in whole cluster]
3,332 / 4,612 / + [in contig]
Location3332..4612 [in whole cluster]
3332..4612 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhodinose glycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)urdGT1a
EC number
Keyword
  • C-12b OH group
Note
Note (GenBank)
  • UrdGT1a; uses TTG start codon
Reference
ACC
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase]
MRVLFSIMPATAHLYPIVPLAWALQASGHEVRVASHPDMAATITAAGLTAVSVGRPADLG
ALMRDGASDQCLEQITEALEIGSDDLNLRNAIRYYTLAGVSLYFPTDPQRAESDRAVDDL
VAFARSWRPDLVLWDPLVLAAPVAARLSGAAHARVLYGLDYVGWAQQRFTERIGRRAQPL
TEHPLAELMRPTLRRFGLDFDAELAVGQWTLDLLPERMRLPVDLRYTALRRVPYTGTTTV
PQWLYDEPKRPRVCLTLGMSTRKFLSGHGASPIADIFGLVEELDIELVATVNSAQLADVE
ELPDRVRIVDYLPLDLLLPTCSAVVHHGGGGTFAAAVAHQVPQLIPAPGEGGDRVAFARY
VEQRGAGLTVSRTDYSADVFAEQLFRVLHEPSFQDGAAGLHDDMLATPSPRDVVPVLEKL
SDRYRR
selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase]
TTGCGTGTCCTCTTTTCGATCATGCCGGCAACAGCGCACTTATATCCGATAGTTCCACTG
GCCTGGGCGCTTCAAGCTAGTGGCCACGAGGTCCGGGTCGCCAGCCACCCCGACATGGCC
GCCACCATAACCGCGGCCGGTCTGACCGCTGTCTCCGTGGGGCGGCCTGCGGACCTCGGG
GCCCTCATGCGGGACGGCGCGAGCGACCAGTGTTTGGAGCAGATCACCGAGGCCCTGGAA
ATTGGTTCCGACGATCTCAATCTGCGCAATGCCATCCGCTATTACACGTTGGCAGGTGTC
TCGCTCTATTTCCCCACCGATCCGCAGCGGGCCGAGAGCGACCGTGCGGTGGACGACCTG
GTGGCCTTCGCCCGGTCCTGGCGACCCGATCTTGTGCTGTGGGATCCCCTGGTCCTGGCG
GCTCCCGTCGCGGCCCGACTCAGCGGAGCCGCGCATGCCCGTGTCCTGTACGGGCTCGAC
TACGTCGGCTGGGCGCAGCAACGGTTCACGGAGCGGATCGGCCGACGGGCCCAGCCGCTC
ACGGAGCATCCGCTCGCGGAACTCATGCGGCCGACCCTCCGACGCTTCGGGCTCGACTTC
GACGCCGAGCTGGCCGTCGGCCAGTGGACACTCGATCTGCTGCCCGAACGCATGCGGTTG
CCGGTCGACCTGCGCTACACGGCGCTGCGCCGAGTCCCGTACACGGGCACGACCACTGTT
CCGCAATGGTTGTACGACGAGCCGAAGCGCCCGCGAGTGTGCCTCACACTGGGCATGAGT
ACACGCAAGTTTCTTTCCGGGCACGGTGCTTCGCCGATCGCCGACATCTTCGGTCTGGTG
GAGGAGCTCGACATCGAGCTGGTCGCCACCGTGAACTCCGCCCAGCTCGCTGACGTGGAG
GAACTCCCCGACCGGGTCCGCATAGTGGACTATCTCCCGCTCGATCTCCTGCTGCCGACC
TGCTCCGCGGTTGTGCACCATGGCGGCGGAGGGACCTTTGCGGCAGCGGTCGCCCACCAG
GTGCCCCAGCTGATCCCGGCACCCGGGGAAGGCGGGGACCGGGTTGCCTTCGCTCGGTAT
GTGGAGCAGCGAGGCGCCGGGCTGACCGTGAGCCGTACCGATTACTCGGCCGATGTCTTC
GCGGAGCAGCTGTTCCGCGTGCTCCACGAGCCCTCGTTCCAGGACGGGGCGGCCGGACTT
CATGACGACATGCTGGCGACACCGAGCCCGCGTGACGTCGTGCCTGTCCTGGAGAAGCTG
TCCGACCGCTACCGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-134]  1.69999999999999e-24 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [211-307]  2.7e-29 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.453 Signal
Bacteria, Gram-positive   
 [1-28]  0.92 Signal
Eukaryota   
 [1-23]  0.543 Signal
Bacteria, Gram-negative   
TMHMM No significant hit