close all open/close all

CDS information : Urd_00040


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction4,629 / 5,795 / + [in whole cluster]
4,629 / 5,795 / + [in contig]
Location4629..5795 [in whole cluster]
4629..5795 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)urdGT1b
EC number
Keyword
  • C-9 trisaccharide
  • 3rd D-olivose
Note
Note (GenBank)
  • UrdGT1b
Reference
ACC
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[11410375] Two sequence elements of glycosyltransferases involved in urdamycin biosynthesis are responsible for substrate specificity and enzymatic activity. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyl transferase]
MRVLMMSTPAPTHFTPLVSLAWALRGSGHEVVVAGQPDVLGAVASAGLNAVNVGDWFHVD
DMLVAGLREGERPLETRPRASLESMGGYGRVWMTHARYLVGRYMEFARIYGPDLIVSDPL
EYSSLLVGGVLGVPVVQQRWGVDLISGPARAEARPGFGPLCERLGLAGLPDPAVLLDPCP
PGLQAPGAEPGSPIRFVPFNGNGVVPGWLREPRSASRPRVVVTLGSRTLALNGVPLMRGI
LRAFEELPEVEAVATVDEVFREKVGPVPANVRMVDPVPLHLVLDGCAAVVHHGGAGTTMT
AGAFGLPQLVLPQLADQFGHGDRVSEVGAGISLDDAESQNDSHRLAVELRRLLAEPEFAK
AARALADSVRDMPAPAQVAADLTRLAGL
selected fasta
>D-olivose glycosyltransferase [glycosyl transferase]
ATGCGTGTACTGATGATGTCAACCCCCGCGCCGACGCATTTCACGCCGTTGGTGTCGTTG
GCGTGGGCCCTGCGGGGTTCGGGCCATGAGGTGGTGGTCGCGGGTCAGCCGGATGTACTG
GGGGCGGTCGCCTCGGCCGGGCTCAACGCGGTGAACGTCGGCGACTGGTTCCACGTGGAC
GACATGTTGGTCGCCGGGTTGCGGGAGGGGGAGCGCCCGCTCGAGACGCGTCCCCGTGCC
TCGCTCGAGTCGATGGGCGGGTACGGGCGGGTGTGGATGACCCATGCGCGTTATCTGGTC
GGGCGGTACATGGAGTTCGCTCGCATCTACGGTCCGGATCTGATCGTGTCGGATCCGCTG
GAGTACAGCTCGCTGCTGGTCGGGGGTGTGCTGGGGGTTCCGGTGGTGCAGCAGCGGTGG
GGGGTGGATCTGATCTCGGGTCCGGCGCGTGCGGAGGCGCGGCCGGGGTTCGGTCCGTTG
TGTGAGCGTCTGGGGCTTGCGGGGCTGCCGGATCCGGCGGTGTTGCTGGATCCGTGTCCG
CCGGGTCTGCAGGCTCCGGGGGCGGAGCCGGGCAGTCCGATCAGGTTCGTTCCGTTCAAC
GGCAACGGGGTGGTGCCGGGGTGGCTGCGCGAGCCGCGGTCCGCATCACGCCCCCGTGTA
GTCGTCACCCTGGGCAGTCGGACGTTGGCGTTGAACGGGGTGCCGTTGATGCGGGGCATT
CTGCGGGCGTTCGAGGAGCTGCCGGAGGTGGAGGCGGTGGCGACGGTGGACGAGGTGTTC
CGGGAGAAGGTCGGGCCGGTGCCGGCCAATGTGCGGATGGTCGATCCGGTGCCGCTGCAC
CTGGTGCTGGACGGATGTGCGGCCGTTGTGCACCACGGGGGCGCGGGTACGACGATGACC
GCCGGGGCGTTCGGGCTGCCCCAGCTGGTACTGCCCCAGCTCGCCGACCAGTTCGGGCAC
GGTGACCGGGTGAGCGAGGTGGGTGCCGGGATCTCGCTGGACGATGCGGAGAGCCAGAAC
GATTCGCATCGGCTGGCCGTGGAACTTCGGCGGCTGTTGGCGGAGCCGGAGTTCGCCAAG
GCCGCCCGCGCGCTGGCCGACTCGGTCCGGGACATGCCCGCACCCGCACAGGTCGCCGCC
GACCTCACACGGCTGGCCGGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-56]  4.2e-09 PF03033
PF03033   Glyco_transf_28
IPR007235 Glycosyl transferase, family 28, C-terminal (Domain)
 [282-364]  6.90000000000001e-05 PF04101
PF04101   Glyco_tran_28_C
IPR010610 Domain of unknown function DUF1205 (Domain)
 [176-272]  1.2e-25 PF06722
PF06722   DUF1205
SignalP
 [1-21]  0.516 Signal
Bacteria, Gram-negative   
 [1-28]  0.964 Signal
Eukaryota   
 [1-23]  0.536 Signal
Bacteria, Gram-positive   
TMHMM No significant hit