close all open/close all

CDS information : Urd_00050


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction7,048 / 5,846 / - [in whole cluster]
7,048 / 5,846 / - [in contig]
Locationcomplement(5846..7048) [in whole cluster]
complement(5846..7048) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)integrase
Gene
Gene (GenBank)urd-Int
EC number
Keyword
Note
Note (GenBank)
  • Urd-Int; uses GTG start codon
Reference
ACC
Family/Domain
FD
IPR003346, IPR002525

close this sectionSequence

selected fasta
>putative transposase [integrase]
MNERKTQVWAGVDAGKGHHWTAVVDETGATLWSKKVDNDESAILTALGEILDLADEVHWA
VDISGTSSALLLALLAAHGQQAVYVPGGTVNRMSGAYRGEAKTDARDTYVIAETARHRND
FTAIDVPAQLAVDLALLTAHRTDLVADRVRMINRLRDVLTGVFPALERAFDYSAHKGALV
LLTGYQTPAAIRRRGRARLTAWLANRGVRGADAVAETALAAAQAQQTALPGEDVAAQIVA
ELAGQLLALDDRMKRIDKQIRETFRSHPQAEIIDSLPGMGPILGAEFVVAVGDLSAYADA
GHLASAAGLVPVPRDSGRRTGNLHRPKRYSRRLRRVFYMSAQTSMTREGPNRDFYLKKRG
EGCQHIQAVIALARRRASVLWALLRDNRVFTPAPPVTQAA
selected fasta
>putative transposase [integrase]
GTGAACGAGCGGAAGACCCAGGTCTGGGCCGGTGTCGATGCCGGCAAGGGCCACCACTGG
ACGGCGGTGGTCGACGAGACCGGCGCGACCCTGTGGTCGAAGAAGGTCGACAACGACGAG
TCGGCGATCCTGACGGCGCTCGGCGAGATCCTGGACCTGGCCGACGAGGTCCACTGGGCG
GTCGACATCTCCGGCACGTCCTCCGCGCTGCTGCTGGCCCTGCTCGCGGCCCATGGCCAG
CAGGCCGTCTACGTGCCTGGCGGCACGGTCAACCGCATGTCGGGCGCATACCGGGGCGAG
GCCAAGACCGACGCCCGTGACACCTACGTCATCGCCGAGACCGCCCGCCACCGCAACGAC
TTCACCGCCATCGACGTGCCCGCCCAGCTGGCCGTCGACCTCGCGCTGCTGACCGCCCAC
CGCACCGACTTGGTGGCCGACCGCGTGCGGATGATCAACCGCCTGCGCGACGTGCTGACT
GGCGTCTTCCCCGCACTGGAGCGGGCTTTCGACTACTCGGCCCACAAAGGCGCGCTCGTC
CTGCTGACGGGCTACCAGACCCCGGCCGCGATCCGCCGCCGCGGCCGGGCGAGGCTGACG
GCCTGGCTGGCCAACCGCGGCGTGCGTGGGGCCGACGCGGTCGCCGAGACCGCACTGGCA
GCAGCCCAAGCCCAGCAGACCGCGCTGCCCGGTGAGGACGTCGCCGCACAGATCGTGGCC
GAACTGGCCGGGCAGCTCCTGGCCCTGGACGACCGGATGAAGCGCATCGACAAGCAGATC
CGCGAGACGTTCCGCAGTCATCCGCAGGCGGAGATCATCGATTCGCTGCCCGGTATGGGC
CCGATACTCGGAGCCGAGTTCGTTGTGGCCGTCGGCGACCTGTCGGCCTACGCCGACGCC
GGCCACCTGGCATCGGCGGCCGGGCTGGTGCCCGTCCCGCGTGACTCCGGTCGCCGGACC
GGCAACCTCCACCGGCCCAAGCGCTACAGCCGACGCCTGCGCAGGGTGTTCTACATGTCC
GCGCAGACGAGCATGACCCGCGAAGGACCGAACCGGGACTTCTACCTGAAGAAGCGCGGC
GAGGGCTGCCAACACATCCAGGCCGTCATCGCCCTGGCCCGCCGACGAGCCAGCGTGTTG
TGGGCCCTGCTGCGTGACAACCGGGTATTCACCCCCGCCCCGCCGGTCACGCAAGCAGCT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002525 Transposase, IS111A/IS1328/IS1533, N-terminal (Domain)
 [10-154]  1.1e-23 PF01548
PF01548   DEDD_Tnp_IS110
IPR003346 Transposase, IS116/IS110/IS902 (Family)
 [270-355]  6.60000000000002e-20 PF02371
PF02371   Transposase_20
SignalP No significant hit
TMHMM No significant hit