close all open/close all

CDS information : Urd_00060


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction7,262 / 8,437 / + [in whole cluster]
7,262 / 8,437 / + [in contig]
Location7262..8437 [in whole cluster]
7262..8437 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhodinose glycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)urdGT1c
EC number
Keyword
  • C-9 trisaccharide
  • 2nd L-rhodinose
Note
Note (GenBank)
  • UrdGT1c
Reference
ACC
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[11410375] Two sequence elements of glycosyltransferases involved in urdamycin biosynthesis are responsible for substrate specificity and enzymatic activity. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase]
MRVLFLVTPSPTHFTPLVSLAWALRGAGHEVVVAGQPDVLGAVASAGLNAVSIGAPFNGE
AKLLAGLGPDQRPLEVRPRPAPESMGGYGRVWMTHARYLVGRYMEFARIYGPDLIVSDPL
EYSSLLVGGVLGVPVVQQRWGVDLISGPARAEARPGFGPLCERLGLAGLPDPAVLLDPCP
PGLQAPGAEPGSPIRFVPFNGNGVVPGWLREPRSASRPRVLVTIGGTLALNGVPLMRGIL
RAFEELPEVEAVATVDEVFREKVGPVPANVRMVDPVPLHLVLDGCAAVVHHGGAGTTMTA
GAFGLPQLVLPQLADHFGHGDRVSEVGAGISLDDAESQNDSHRLAVELRRLLAEPEFAKA
ARALADSVRDMPAPAQVAADLTRIAGVVGAL
selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase]
ATGCGAGTCCTGTTTCTGGTGACACCCTCGCCGACGCATTTCACGCCGTTGGTGTCATTG
GCGTGGGCCCTGCGGGGTGCGGGCCATGAGGTGGTGGTCGCGGGTCAGCCGGATGTACTG
GGGGCGGTCGCCTCGGCCGGGCTCAACGCGGTGAGCATCGGCGCACCGTTCAACGGGGAG
GCGAAGCTGCTCGCCGGACTGGGCCCCGATCAGCGGCCGCTGGAGGTACGGCCCCGCCCG
GCGCCTGAGTCGATGGGCGGGTACGGGCGGGTGTGGATGACCCATGCGCGTTATCTGGTC
GGGCGGTACATGGAGTTCGCTCGCATCTACGGTCCGGATCTGATCGTGTCGGATCCGCTG
GAGTACAGCTCGCTGCTGGTCGGGGGTGTGCTGGGGGTTCCGGTGGTGCAGCAGCGGTGG
GGGGTGGATCTGATCTCGGGTCCGGCGCGTGCGGAGGCGCGGCCGGGGTTCGGTCCGTTG
TGTGAGCGTCTGGGGCTTGCGGGGCTGCCGGATCCGGCGGTGTTGCTGGATCCGTGTCCG
CCGGGTCTGCAGGCTCCGGGGGCGGAGCCGGGCAGTCCGATCAGGTTCGTTCCGTTCAAC
GGCAACGGGGTGGTGCCGGGGTGGCTGCGCGAGCCGCGGTCCGCATCACGCCCCCGTGTA
CTCGTCACCATCGGTGGCACGTTGGCGTTGAACGGGGTGCCGTTGATGCGGGGCATTCTG
CGGGCGTTCGAGGAGCTGCCGGAGGTGGAGGCGGTGGCGACGGTGGACGAGGTGTTCCGG
GAGAAGGTCGGGCCGGTGCCGGCCAATGTGCGGATGGTCGATCCGGTGCCGCTGCACCTG
GTGCTGGACGGATGTGCGGCCGTTGTGCACCACGGGGGCGCGGGTACGACGATGACCGCC
GGGGCGTTCGGGCTGCCCCAGCTGGTACTGCCCCAGCTCGCCGACCACTTCGGGCACGGT
GACCGGGTGAGCGAGGTGGGTGCCGGGATCTCGCTGGACGATGCGGAGAGCCAGAACGAT
TCGCATCGGCTGGCCGTGGAACTTCGGCGGCTGTTGGCGGAGCCGGAGTTCGCCAAGGCC
GCCCGCGCGCTGGCCGACTCGGTCCGGGACATGCCCGCACCCGCACAGGTCGCCGCCGAC
CTCACACGCATCGCGGGTGTCGTCGGCGCCCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-61]  1.2e-10 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [176-271]  5.40000000000002e-25 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.581 Signal
Bacteria, Gram-positive   
 [1-21]  0.47 Signal
Bacteria, Gram-negative   
 [1-28]  0.949 Signal
Eukaryota   
TMHMM No significant hit