close all open/close all

CDS information : Urd_00070


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction9,120 / 8,557 / - [in whole cluster]
9,120 / 8,557 / - [in contig]
Locationcomplement(8557..9120) [in whole cluster]
complement(8557..9120) [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)regulatory protein
Gene
Gene (GenBank)urdK
EC number
Keyword
Note
Note (GenBank)
  • UrdK
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q9ZGB7
NITE
Lando_00230
PmId
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)
[20583594] Properties of lanK-based regulatory circuit involved in landomycin biosynthesis in Streptomyces cyanogenus S136. (Genetika. , 2010)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [regulatory protein]
MTTPKSTRQKIQEVALELFVEQGYEKTSLRGIAERLNVTKPAIYYHFQTKEAILISLFQD
LGQPLAEIIAWAQEQPRTLETKKELLTRYSIALHNAAPLFRFMQENQATVRQLSVGQDFK
DRVGAMAGLIKEPGAPLADQVRCISALFTVHFGTFAMQELDGDPEDKRQELLDVAIELVS
TVHSGAV
selected fasta
>putative TetR family transcriptional regulator [regulatory protein]
ATGACAACGCCCAAGTCCACCCGCCAGAAGATTCAGGAAGTCGCCCTCGAACTCTTCGTC
GAGCAGGGCTATGAGAAGACTTCACTCCGCGGGATCGCCGAGAGACTGAATGTGACAAAA
CCAGCCATTTACTACCATTTTCAGACGAAGGAGGCCATTCTCATCAGCCTCTTCCAGGAT
CTGGGGCAGCCGCTGGCGGAGATCATCGCTTGGGCGCAGGAACAGCCCCGCACTCTGGAG
ACGAAGAAGGAACTGCTCACCCGGTACAGCATCGCCCTGCACAACGCGGCACCACTCTTC
CGGTTCATGCAGGAGAACCAGGCCACGGTGCGACAGCTCAGTGTCGGTCAGGATTTCAAG
GACCGGGTCGGCGCCATGGCGGGCCTGATCAAGGAGCCGGGTGCCCCGCTCGCGGACCAG
GTCCGCTGCATCAGCGCGCTGTTCACCGTCCATTTCGGCACCTTCGCGATGCAGGAACTG
GACGGCGATCCCGAGGACAAGCGCCAGGAGTTGCTCGATGTCGCCATTGAGCTGGTCTCG
ACGGTGCACTCGGGGGCAGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [11-56]  4.70000000000001e-18 PF00440
PF00440   TetR_N
 [5-65]  PS50977
PS50977   HTH_TETR_2
 [11-24]  5.09999882439978e-11 PR00455 [32-55]  5.09999882439978e-11 PR00455
PR00455   HTHTETR
IPR009057 Homeodomain-like (Domain)
 [3-76]  4.19999771339581e-18 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [5-179]  1.9e-27 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [23-54]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit