close all open/close all

CDS information : Urd_00080


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction9,248 / 10,825 / + [in whole cluster]
9,248 / 10,825 / + [in contig]
Location9248..10825 [in whole cluster]
9248..10825 [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transporter
Gene
Gene (GenBank)urdJ
EC number
Keyword
Note
Note (GenBank)
  • UrdJ
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q9ZGB6
NITE
Lando_00240
PmId
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transporter]
MQYELAESGTSSSSQQPRGLRVSLVALLIAMLLATLDNLILGAAMPTIVGELDGLDHLSW
VVTAYALATAAATPIWGKLGDMYGRKVVFLAAIGVFLLGSALAGASQTMEQLIAFRAVQG
LGAGGLMVGAFAIIGDIVPGRERGKYQGMMSAVMGLAMVAGPLAGGLITDHLGWRWCFYI
NLPLGGVAICMVIAVLRLPKKRAQARIDYLGPILLAASISSLVLMTTWGGGQYSWGSVQI
LGLGALVLVGGVLFVLVERRAAEPVLPLAVFRNSNFSLITAVGFLLGFVQLGALTFLPLF
LQTVQGASATNSGFLLFPVFGSMMVVNVIAGRVTTQTGKYKIFLVVGQRLVCLGPFLLAQ
MDTGTSRVTSGVFMAVLGLGMGLLMQSVMLVALESVEKKDLGVASSTATLSRTIGGSIGV
AIMGALFTRQVQDSMAGRGPELSSAAGENMRLDAASLSRLPQDIRSAYESAVASGTHQAF
LLGAAAALVAFAASCFVREVPLRGAEEQENSAAAPRGDQARVDEK
selected fasta
>putative drug resistance transporter [transporter]
ATGCAGTACGAATTAGCCGAATCCGGAACATCGTCGTCGAGCCAACAGCCCCGTGGCCTG
CGGGTCTCGCTCGTCGCCCTGCTCATCGCCATGTTGCTCGCCACGCTGGACAATCTGATC
CTCGGCGCAGCGATGCCGACCATCGTCGGCGAGCTCGACGGCCTCGACCATCTCTCCTGG
GTGGTCACGGCCTACGCCCTCGCCACCGCGGCCGCCACGCCCATCTGGGGCAAGCTCGGG
GACATGTACGGCCGCAAGGTGGTGTTCCTGGCCGCGATCGGCGTCTTCCTCCTCGGATCT
GCACTCGCCGGCGCTTCGCAGACCATGGAACAGCTCATCGCCTTCCGGGCCGTGCAGGGT
CTGGGCGCCGGGGGACTGATGGTCGGAGCGTTCGCGATCATCGGGGACATCGTCCCCGGC
CGTGAGCGGGGCAAGTACCAGGGCATGATGTCGGCGGTGATGGGGCTCGCCATGGTCGCC
GGCCCTCTGGCCGGTGGCCTGATCACCGACCACCTCGGCTGGCGCTGGTGCTTTTACATC
AACCTTCCCCTGGGCGGCGTCGCCATCTGCATGGTCATCGCCGTCCTGCGGCTACCGAAG
AAGCGGGCGCAGGCGCGGATCGACTACCTGGGCCCGATCCTGCTGGCCGCGTCCATCAGT
TCCCTGGTGCTCATGACCACCTGGGGCGGTGGCCAGTACTCCTGGGGATCGGTGCAGATC
CTGGGACTCGGTGCCCTGGTCCTTGTGGGTGGCGTGCTGTTCGTGCTCGTCGAGCGCCGG
GCCGCCGAACCGGTGCTGCCGCTGGCGGTGTTCCGGAACTCGAACTTCTCCCTCATCACC
GCCGTCGGCTTTCTCCTCGGCTTCGTCCAGCTCGGCGCTCTGACGTTCCTTCCGCTCTTC
CTGCAGACGGTGCAAGGCGCTTCCGCCACCAACTCCGGGTTCCTGTTGTTCCCCGTCTTC
GGCTCGATGATGGTGGTCAACGTGATCGCGGGGCGGGTGACCACACAGACGGGCAAGTAC
AAGATCTTCCTGGTTGTGGGGCAGCGCCTGGTCTGCCTGGGACCCTTCCTCCTGGCGCAG
ATGGACACCGGCACCTCCCGCGTCACGTCTGGTGTCTTCATGGCTGTGCTCGGCCTGGGG
ATGGGTCTGCTGATGCAGAGCGTGATGCTCGTCGCCCTGGAGAGCGTGGAGAAGAAGGAC
CTCGGTGTCGCGTCGTCCACGGCGACCCTGTCGCGCACCATCGGCGGGTCGATCGGTGTG
GCGATCATGGGTGCGCTGTTCACCCGGCAGGTGCAGGACTCCATGGCGGGACGCGGACCC
GAGCTCTCCTCGGCGGCCGGCGAGAACATGCGGCTGGACGCCGCCTCGCTGTCCCGTCTT
CCGCAGGACATCCGCAGTGCCTACGAGTCCGCGGTCGCCTCGGGCACGCACCAGGCCTTC
CTGCTCGGCGCGGCGGCGGCGCTGGTCGCGTTCGCCGCCTCGTGCTTCGTCAGGGAAGTT
CCGCTGCGGGGGGCGGAGGAGCAGGAGAACAGCGCTGCCGCCCCACGCGGCGATCAAGCT
CGCGTCGACGAGAAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [26-50]  1.30000067202732e-08 PR01036 [116-136]  1.30000067202732e-08 PR01036 [146-170]  1.30000067202732e-08 PR01036 [211-229]  1.30000067202732e-08 PR01036 [410-429]  1.30000067202732e-08 PR01036
PR01036   TCRTETB
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [24-492]  7.69999999999997e-78 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [27-419]  8.70000000000003e-52 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [7-509]  4.50001022902825e-78 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [23-502]  PS50850
PS50850   MFS
SignalP
 [1-43]  0.358 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [87-109]  Transmembrane (i-o) [113-135]  Transmembrane (o-i) [147-169]  Transmembrane (i-o) [174-196]  Transmembrane (o-i) [209-231]  Transmembrane (i-o) [235-257]  Transmembrane (o-i) [277-299]  Transmembrane (i-o) [309-331]  Transmembrane (o-i) [371-393]  Transmembrane (i-o) [408-427]  Transmembrane (o-i)
Transmembrane 12