close all open/close all

CDS information : Urd_00090


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction10,886 / 11,479 / + [in whole cluster]
10,886 / 11,479 / + [in contig]
Location10886..11479 [in whole cluster]
10886..11479 [in contig]
TypeCDS
Length594 bp (197 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)UrdO
Gene
Gene (GenBank)urdO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q9ZGB0
NITE
Lando_00300
PmId
[15812784] Generation of novel landomycins M and O through targeted gene disruption. (Chembiochem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)
ACC
Q6T1C6
PmId
[15123249] Generation of new landomycins by combinatorial biosynthetic manipulation of the LndGT4 gene of the landomycin E cluster in S. globisporus. (Chem Biol. , 2004)
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [UrdO]
MSDAPVRLAVIIGSVREGRFGPTVANWFAGEAKQHDAFEVDVIDLAEANLPGVLPAFGAT
PAPETVEAVGKVTPRLENADAFVVVTPEYNHSYPASVKTLIDWHNAQWHAKPIGFVSYGG
LSGGLRAVEHLRVVFAEVHAITIRDTVSFHSAWSQFDETGLPRDPEGCTAAAQTLLGQLS
WWARALREARTREPYKV
selected fasta
>putative oxidoreductase [UrdO]
ATGTCTGATGCTCCCGTCCGACTCGCCGTCATCATCGGCAGCGTGCGCGAAGGACGTTTC
GGCCCGACCGTTGCCAACTGGTTCGCCGGGGAGGCGAAGCAGCACGACGCCTTCGAGGTC
GATGTGATCGACCTTGCGGAGGCGAATCTTCCCGGCGTGCTGCCCGCGTTCGGAGCGACG
CCCGCGCCGGAGACGGTGGAAGCGGTGGGCAAGGTCACGCCGCGTCTTGAAAATGCGGAC
GCGTTCGTCGTGGTAACTCCCGAATACAACCACAGCTACCCGGCCTCGGTGAAGACCCTG
ATTGACTGGCACAACGCCCAGTGGCACGCCAAGCCGATCGGTTTCGTCTCCTATGGCGGC
CTTTCCGGCGGGCTGCGCGCGGTGGAACACCTCCGCGTGGTCTTCGCCGAAGTGCACGCG
ATCACCATTCGCGACACCGTCAGTTTCCACAGCGCCTGGTCGCAGTTCGACGAGACCGGG
CTCCCCAGGGACCCTGAGGGCTGCACCGCGGCCGCCCAGACTCTGCTCGGCCAGCTGTCG
TGGTGGGCGCGGGCGCTCCGTGAGGCAAGGACTCGCGAGCCGTACAAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [7-153]  5.40000000000002e-40 PF03358
PF03358   FMN_red
SignalP No significant hit
TMHMM No significant hit