close all open/close all

CDS information : Urd_00100


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction11,812 / 13,299 / + [in whole cluster]
22 / 1,509 / + [in contig]
Location11812..13299 [in whole cluster]
22..1509 [in contig]
TypeCDS
Length1,488 bp (495 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
ProductC-12/C-12b hydroxylase
Product (GenBank)putative oxygenase
GeneurdE
Gene (GenBank)UrdE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
Related Reference
ACC
Q93LY7
PmId
[17654627] Artificial reconstruction of two cryptic angucycline antibiotic biosynthetic pathways. (Chembiochem. , 2007)
[18291320] Sequential action of two flavoenzymes, PgaE and PgaM, in angucycline biosynthesis: chemoenzymatic synthesis of gaudimycin C. (Chem Biol. , 2008)
[21595438] Flavoprotein hydroxylase PgaE catalyzes two consecutive oxygen-dependent tailoring reactions in angucycline biosynthesis. (Biochemistry. , 2011)

close this sectionSequence

selected fasta
>C-12/C-12b hydroxylase [putative oxygenase]
MDASVIVAGAGPTGLMLAGELRLAGVDVIVLDRLAERTGESRGLGFTTRTMEVFDQRGLL
HRLGDMGTSNAGHFGGLPVDFGVLDSVHQAAKTVPQSDTETMLEGWARELGADIRRGHEL
VTLHDHGDHVEAEVRGPEDEKIRLTAPYLVGCDGGRSTVRKAVGFDFPGTAATMEMYLAD
IKGVDLKPRLIGETHPGGMVMSGPLGDRGVTRIIVCERGTPPRRRTEPPSYAEVAAAWQR
ITGIDISHAEHEWVSAFGDATRLVTEYRRGRVLLAGDAAHIHLPAGGQGMNTGIQDAVNL
GWKLAAVLRGTASESLLDSYHSERHAVGERLMMNTKAQGLLFLSGAEVQPLRDVLAELIR
YEEVSRHLAGMVSGLEIRYDVGPGSHPLLGLRMPHLELVGERRKTSSTELLHAGRGLLLD
LEDNAVLRERAVGWLDRVDLVTAVPHGVPAGSPLSRTSAFLVRPDGHVAWAAPGSHHALP
MALERWFGPSRIQQS
selected fasta
>C-12/C-12b hydroxylase [putative oxygenase]
ATGGATGCTTCAGTCATCGTCGCCGGCGCAGGGCCCACTGGACTCATGCTCGCCGGGGAA
CTGCGGCTCGCAGGGGTCGACGTCATCGTGCTCGACCGCTTGGCGGAACGCACCGGGGAG
TCACGTGGGCTGGGTTTCACCACGCGCACGATGGAGGTCTTCGACCAGCGCGGCCTGCTG
CACCGCCTCGGTGACATGGGCACCAGCAACGCCGGTCATTTCGGGGGTCTGCCGGTCGAC
TTCGGCGTTCTGGACAGTGTTCACCAGGCGGCCAAGACCGTTCCGCAGTCGGACACCGAG
ACGATGCTCGAAGGCTGGGCGCGTGAGCTGGGCGCGGACATCCGGCGTGGACACGAACTC
GTCACCCTGCACGACCACGGTGACCACGTCGAGGCCGAGGTCCGCGGCCCGGAAGACGAG
AAGATCCGGTTGACCGCTCCCTACCTCGTGGGATGCGACGGCGGTCGCAGCACGGTACGC
AAGGCGGTCGGCTTCGACTTCCCCGGTACCGCGGCAACCATGGAGATGTACCTGGCGGAC
ATCAAGGGTGTGGACCTGAAGCCGCGGCTGATCGGCGAAACCCACCCCGGCGGCATGGTG
ATGAGCGGCCCGCTCGGCGATCGCGGCGTCACCCGCATCATTGTCTGCGAACGCGGCACC
CCGCCCCGCCGACGCACCGAACCCCCTTCGTACGCGGAAGTGGCCGCGGCCTGGCAGCGG
ATTACGGGCATCGACATCTCGCACGCCGAGCATGAGTGGGTCAGCGCGTTCGGCGACGCG
ACCCGGCTCGTCACCGAATACCGGCGAGGCCGAGTGCTGCTGGCCGGTGACGCCGCGCAC
ATCCATCTGCCGGCCGGCGGGCAGGGGATGAACACCGGCATCCAGGACGCCGTCAACCTG
GGCTGGAAGCTGGCCGCCGTGCTCCGCGGCACCGCCTCCGAGTCGCTGCTGGACAGTTAT
CACAGCGAGCGGCATGCGGTCGGCGAGCGGCTGATGATGAACACCAAGGCGCAGGGCCTG
CTCTTCCTCAGTGGTGCGGAGGTCCAGCCGCTGCGCGACGTACTGGCCGAGCTGATCCGC
TACGAGGAGGTCAGCCGCCATCTCGCCGGCATGGTGAGCGGTTTGGAGATCCGCTACGAC
GTCGGCCCGGGCAGCCACCCGCTCCTGGGGCTGCGCATGCCGCACCTGGAGCTGGTGGGC
GAACGGCGCAAGACCAGCAGTACCGAACTGCTGCACGCCGGGCGGGGCCTGCTGCTCGAC
CTGGAGGACAACGCCGTTCTCCGCGAACGTGCCGTCGGCTGGCTGGACCGCGTGGACCTG
GTCACCGCGGTGCCGCACGGTGTCCCGGCGGGCAGCCCGCTGTCCCGAACCTCGGCATTC
CTCGTGCGCCCTGACGGGCATGTGGCCTGGGCCGCGCCGGGCAGCCACCACGCCCTGCCC
ATGGCACTGGAGCGCTGGTTCGGCCCTTCCCGGATCCAGCAGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [3-334]  8.80000000000003e-101 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [4-26]  3.59998852907783e-46 PR00420 [145-160]  3.59998852907783e-46 PR00420 [269-284]  3.59998852907783e-46 PR00420 [284-300]  3.59998852907783e-46 PR00420 [302-320]  3.59998852907783e-46 PR00420 [320-336]  3.59998852907783e-46 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit