close all open/close all

CDS information : Urd_00110


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction13,313 / 13,639 / + [in whole cluster]
1,523 / 1,849 / + [in contig]
Location13313..13639 [in whole cluster]
1523..1849 [in contig]
TypeCDS
Length327 bp (108 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative cyclase
GeneurdF
Gene (GenBank)UrdF
EC number
Keyword
  • angucycline
Note
Note (GenBank)
Reference
ACC
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
Related Reference
ACC
Q9XCV6
NITE
Jado_00070
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative cyclase [putative cyclase]
MHSTLIVARMEPRSAEDVARLFSEFDGTDMPHRMGTRRRQLFSYRGLYFHLQDFDSEDGG
ERIEAAKTDQRFIGISEDLKPFIAAYDPDTWRSPADAMAQRFYHWTAL
selected fasta
>putative cyclase [putative cyclase]
ATGCACAGCACTTTGATCGTGGCCCGGATGGAGCCCCGTTCCGCCGAGGACGTCGCCCGC
CTCTTCTCCGAGTTCGACGGCACGGACATGCCGCACCGGATGGGCACCCGGCGCCGGCAG
CTCTTCTCGTACCGCGGCCTGTACTTCCACCTCCAGGACTTCGACAGCGAGGACGGCGGC
GAGCGGATCGAGGCGGCGAAGACGGACCAGCGGTTCATCGGCATCAGCGAGGACCTCAAA
CCGTTCATCGCTGCGTACGATCCCGACACTTGGCGGTCACCCGCCGACGCCATGGCCCAG
CGGTTCTACCACTGGACCGCGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [10-107]  1.2e-41 PF04673
PF04673   Cyclase_polyket
 [2-107]  PD012644
PD012644   Polyketide_synth_cyclase
 [1-107]  2.89999999999999e-49 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-108]  3.19999899046351e-44 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit