close all open/close all

CDS information : Urd_00120


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction13,636 / 14,916 / + [in whole cluster]
1,846 / 3,126 / + [in contig]
Location13636..14916 [in whole cluster]
1846..3126 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)putative ketoacyl synthase
GeneurdA
Gene (GenBank)UrdA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • gtg start
Reference
ACC
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS7..379

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative ketoacyl synthase]
MSGAHSRRVVITGIGVTAPGGVGSKNFWSLLSDGRTATRRISFFDPSPFRSQVAAEADFD
AELLGLSPQEIRRMDRAAQFAVVTAREAVADSGLEFASLDPHRTGVTVGSAVGATMGLDQ
EYRTVSDSGRLDLVDHEYAVPHLYNYLVPSSFAAEVAWAVGAEGPATVVSTGCTSGLDAV
GYATELIREGSADVMVAGAADAPISPITVACFDAIKATTPRNEDPEHASRPFDGTRNGFV
LGEGSAVFVLEELDSALRRGAHVYAEIAGYATRSNAFHMTGLRPDGREMAEAIRIALDEA
RLNPEDIDYVNAHGSGTKQNDRHETAAFKRSLGDHAYAVPVSSIKSMVGHSLGAIGSIEI
AASALAMEHGVVPPTANLHTPDPECDLDYVPRTARDWKTDAVLSVGSGFGGFQSAIVLAR
PDRRTA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative ketoacyl synthase]
GTGAGCGGCGCGCACAGCCGACGCGTCGTGATCACCGGCATCGGTGTCACCGCGCCCGGC
GGGGTGGGCAGCAAGAACTTCTGGAGCCTGCTGTCCGACGGGCGCACGGCCACTCGGCGC
ATCAGCTTCTTCGACCCGTCCCCGTTCCGTTCCCAGGTCGCCGCGGAGGCCGATTTCGAC
GCCGAACTGCTGGGCCTGAGCCCACAGGAGATCCGGCGAATGGACCGGGCCGCGCAGTTT
GCCGTGGTCACTGCCCGGGAGGCGGTGGCGGACAGCGGCCTGGAGTTCGCCTCTCTCGAC
CCGCACCGCACCGGCGTGACCGTCGGCAGCGCGGTCGGCGCGACCATGGGGCTCGACCAG
GAGTATCGCACCGTCAGCGACAGCGGGCGGCTCGATCTCGTCGATCACGAGTACGCGGTC
CCGCACCTGTACAACTACCTGGTGCCCAGCTCCTTCGCCGCCGAGGTGGCCTGGGCCGTC
GGCGCCGAGGGCCCGGCGACGGTGGTCTCCACCGGGTGTACGTCCGGCCTCGACGCCGTG
GGTTACGCCACTGAGCTGATCCGCGAGGGCTCCGCCGACGTCATGGTGGCCGGAGCGGCC
GACGCCCCGATCTCGCCCATCACCGTGGCCTGCTTCGATGCGATCAAGGCGACCACACCG
CGCAACGAGGACCCGGAACACGCCTCGCGCCCGTTCGACGGCACCCGCAACGGGTTCGTC
CTGGGCGAGGGATCGGCCGTGTTCGTCCTGGAAGAACTGGACAGTGCCCTGCGGCGAGGC
GCTCATGTGTACGCGGAGATCGCCGGGTATGCGACGCGCAGCAACGCCTTCCACATGACC
GGCCTGCGCCCCGATGGCCGTGAGATGGCCGAGGCCATCCGCATCGCCCTGGACGAGGCC
CGGCTCAACCCCGAGGACATCGACTACGTCAACGCGCACGGCTCGGGTACCAAGCAGAAC
GACCGGCACGAGACAGCCGCCTTCAAGCGCAGCCTCGGCGACCACGCGTATGCCGTGCCC
GTCAGCTCCATCAAATCGATGGTCGGCCACTCGCTGGGTGCCATCGGCTCGATCGAAATC
GCAGCGAGCGCACTGGCGATGGAGCACGGTGTCGTTCCCCCCACCGCCAACCTGCACACA
CCCGACCCCGAGTGCGACCTCGACTATGTGCCGCGGACCGCACGGGACTGGAAGACCGAC
GCCGTACTCTCCGTGGGCAGCGGCTTCGGCGGGTTCCAGAGTGCCATCGTGCTGGCCCGC
CCCGATCGGAGGACCGCGTGA
KS7..379
KS19..1137

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [7-255]  3.90000000000001e-65 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-379]  1.2e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-269]  5.69999999999998e-67 G3DSA:3.40.47.10 [274-421]  1.6e-56 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [6-423]  1.79999754022378e-72 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [164-180]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-24]  0.6 Signal
Eukaryota   
TMHMM No significant hit