close all open/close all

CDS information : Urd_00130


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction14,913 / 16,139 / + [in whole cluster]
3,123 / 4,349 / + [in contig]
Location14913..16139 [in whole cluster]
3123..4349 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)putative chain length determinant
GeneurdB
Gene (GenBank)UrdB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • gtg start
Reference
ACC
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
[14734170] Expression of the landomycin biosynthetic gene cluster in a PKS mutant of Streptomyces fradiae is dependent on the coexpression of a putative transcriptional activator gene. (FEMS Microbiol Lett. , 2004)

close this sectionPKS/NRPS Module

CLF7..365

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [putative chain length determinant]
MNTGAVEVAVTGLGVVAPNGLGTDAYWAATRKGTSGIARISRFDPSRYPVQLAGEIEGFD
AKGHLPGRLLPQTDRMTQLALVAADWAFEDAAVRPGDLPEFEMGVITASSSGGFEFGQRE
LQALWSRGSRYVSAYQSFAWFYAVNSGQISIRNGMRGPSGVVVSDQAGGLDAVAQARRQI
RKGTRLVMSGAVDASICPWGWVAQMASNRLSTSRDPERAYLPFDDAAGGHVPGEGGALLV
LEELEQARARGARQIYGVIAGYGSTLDPRPGSGRPAGLRKAIELALADAGAAPEEIDVVF
ADAAAVPELDRIEAEALTQVFGARAVPVTAPKTMTGRLYSGAAPLDLAAAFLAMRDGVVP
PSVGVSPSPDHDLDLVVHQERAMTVRSALVIARGHGGFNSAVVVRAVG
selected fasta
>polyketide synthase chain length factor subunit [putative chain length determinant]
GTGAACACAGGCGCTGTCGAAGTCGCAGTCACCGGACTGGGCGTGGTCGCTCCCAACGGC
CTCGGCACGGACGCCTACTGGGCGGCGACCCGCAAGGGAACCAGCGGCATCGCACGGATC
TCCCGCTTCGACCCCTCGCGGTACCCGGTCCAACTGGCCGGTGAGATCGAGGGGTTCGAC
GCGAAGGGGCATCTGCCGGGCCGATTGCTGCCGCAGACCGACCGGATGACCCAGCTCGCT
CTCGTGGCCGCGGACTGGGCGTTCGAGGATGCCGCCGTGCGCCCCGGGGACCTGCCCGAG
TTCGAGATGGGTGTGATCACGGCCAGCTCCTCGGGCGGCTTCGAGTTCGGTCAGCGGGAG
CTGCAGGCCCTGTGGAGCCGGGGCAGCAGGTATGTCAGCGCGTACCAGTCCTTCGCCTGG
TTCTACGCCGTCAACAGCGGCCAGATCTCGATCCGCAACGGCATGCGTGGCCCGAGCGGC
GTGGTCGTCAGCGACCAGGCCGGCGGGCTCGACGCCGTGGCCCAGGCGCGACGGCAGATC
CGCAAGGGCACCAGGCTGGTGATGTCGGGCGCCGTCGACGCCTCGATCTGCCCCTGGGGC
TGGGTCGCGCAGATGGCAAGCAACCGGCTGAGCACCAGCCGCGACCCCGAGCGGGCCTAC
CTCCCCTTCGACGACGCCGCGGGTGGACACGTACCCGGCGAGGGCGGTGCCCTGCTCGTC
CTGGAGGAACTGGAGCAGGCCCGTGCTCGGGGCGCCCGGCAGATCTACGGCGTGATCGCC
GGGTACGGCTCCACGCTCGACCCCCGCCCCGGCAGCGGACGTCCCGCAGGCTTGCGCAAG
GCGATCGAGCTGGCGCTGGCCGATGCCGGGGCCGCACCCGAGGAGATCGATGTGGTGTTC
GCCGATGCGGCCGCGGTCCCCGAGCTGGACCGGATCGAGGCCGAGGCCCTCACCCAGGTG
TTCGGAGCCCGTGCAGTGCCGGTGACGGCACCTAAGACGATGACCGGCCGGCTCTACTCC
GGCGCCGCGCCCCTGGACCTGGCGGCCGCGTTCCTCGCCATGCGGGACGGAGTCGTCCCG
CCGTCCGTCGGCGTCTCTCCCTCTCCCGACCACGACCTCGACCTGGTCGTCCACCAGGAG
AGGGCCATGACAGTGCGCTCCGCCCTGGTGATCGCCCGCGGCCACGGCGGTTTCAACTCC
GCGGTCGTCGTGCGCGCCGTCGGATAG
CLF7..365
CLF19..1095

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [7-247]  6.59999999999996e-58 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [256-365]  1.8e-27 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-261]  4.39999999999997e-57 G3DSA:3.40.47.10 [273-406]  1.29999999999998e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [5-252]  3.80000697093588e-63 SSF53901 [215-407]  2.1000026783403e-49 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit