close all open/close all

CDS information : Urd_00140


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction16,247 / 16,516 / + [in whole cluster]
4,457 / 4,726 / + [in contig]
Location16247..16516 [in whole cluster]
4457..4726 [in contig]
TypeCDS
Length270 bp (89 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)putative acyl carrier protein
GeneurdC
Gene (GenBank)UrdC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)
[14734170] Expression of the landomycin biosynthetic gene cluster in a PKS mutant of Streptomyces fradiae is dependent on the coexpression of a putative transcriptional activator gene. (FEMS Microbiol Lett. , 2004)

close this sectionPKS/NRPS Module

ACP7..80

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein]
MPAHEFTIDDLKRILREGAGADEGVNLDGEITDTDFESLGYESLAMLETGGRIEREFGVT
LDDDTLTEAKTPRALIEAVNALLVPAEIG
selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein]
ATGCCCGCCCACGAATTCACCATCGACGACCTCAAGCGCATCCTGCGCGAGGGGGCCGGC
GCGGACGAGGGCGTCAACCTCGACGGCGAGATCACCGACACCGACTTCGAGTCCCTGGGC
TACGAGTCCCTGGCCATGCTGGAGACCGGTGGCCGCATCGAGCGAGAGTTCGGCGTCACC
CTGGACGACGACACGCTGACGGAGGCGAAGACGCCACGCGCCCTGATCGAGGCCGTCAAC
GCCCTTCTGGTGCCCGCCGAGATCGGCTGA
ACP7..80
ACP19..240

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [38-53]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [31-79]  3.90000000000001e-10 PF00550
PF00550   PP-binding
 [3-86]  3.00000067992871e-15 SSF47336
SSF47336   ACP_like
 [5-83]  4.1e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [7-80]  PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-21]  0.068 Signal
Bacteria, Gram-positive   
TMHMM No significant hit