close all open/close all

CDS information : Urd_00160


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction17,491 / 18,426 / + [in whole cluster]
1 / 936 / + [in contig]
Location17491..18426 [in whole cluster]
1..936 [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase
Gene
Gene (GenBank)urdL
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • UrdL
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase]
MTTRSVEHEITVEAPAAAVYRLIAEVENWPRIFPPTIYVEHLERGEGEERIRIWATANGK
AKNWTSRRTLDADNLRITFRQEVSTPPVAAMGGTWIIEPLSGDSSRIRLLHDYRAVDDDP
QGLKWIDEAVDRNSRSELAALKTNVELAHASEEITFSFEDTVWIDGSAKDAYDFVNEAGL
WVERLSHVASVRFSEDTPGLQSLEMDTLAKDGSTHTTKSYRVTFPHHRIAYKQVTLPALM
TLHTGYWTFTENESGTAASSQHTVVLNTENIAGILGPEATVADAREFIRGALSTNSRATL
GHAKDYAENKR
selected fasta
>putative cyclase/dehydratase [cyclase]
ATGACGACCCGGTCAGTCGAGCACGAGATCACCGTCGAGGCCCCGGCCGCCGCCGTCTAC
CGGCTCATCGCCGAGGTGGAGAACTGGCCGCGGATTTTCCCGCCCACCATCTACGTCGAA
CACCTGGAGCGCGGTGAAGGCGAAGAACGGATACGGATCTGGGCCACCGCAAACGGCAAG
GCAAAGAACTGGACCTCCCGCCGCACCCTCGACGCGGACAACCTGCGGATCACCTTCCGG
CAGGAGGTCTCCACCCCGCCCGTCGCCGCGATGGGCGGCACCTGGATCATCGAACCGCTG
TCCGGCGACTCGTCCCGGATCAGGCTGCTGCACGACTACCGGGCGGTCGACGACGACCCC
CAGGGCCTGAAGTGGATCGACGAGGCCGTCGACCGCAACTCGCGCTCGGAGCTGGCCGCG
CTGAAGACCAACGTCGAACTCGCCCACGCCTCCGAGGAGATCACCTTCTCCTTCGAGGAC
ACCGTGTGGATCGACGGCTCCGCCAAGGACGCGTACGACTTCGTCAACGAGGCCGGGCTG
TGGGTGGAGCGGCTGTCACACGTGGCCTCCGTGCGCTTCAGCGAGGACACCCCGGGCCTG
CAGTCGCTGGAGATGGACACCCTCGCCAAGGACGGCTCGACGCACACCACGAAGTCGTAC
CGGGTGACGTTCCCGCACCACAGGATCGCCTACAAGCAGGTCACCCTGCCCGCGCTGATG
ACCCTGCACACCGGCTACTGGACCTTCACCGAGAACGAGTCGGGCACCGCCGCCTCCTCG
CAGCACACCGTGGTCCTCAACACGGAGAACATCGCCGGGATCCTGGGCCCGGAGGCCACC
GTTGCGGACGCCCGGGAGTTCATCCGCGGCGCGCTCAGCACCAACAGTCGTGCCACCCTG
GGCCACGCCAAGGACTACGCCGAGAACAAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [5-146]  1e-13 PF10604 [156-306]  0.00014 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [5-114]  1.5e-15 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit