close all open/close all

CDS information : Urd_00180


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction20,435 / 21,688 / + [in whole cluster]
2,945 / 4,198 / + [in contig]
Location20435..21688 [in whole cluster]
2945..4198 [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)transporter
Gene
Gene (GenBank)urdJ2
EC number
Keyword
Note
Note (GenBank)
  • UrdJ2
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [transporter]
MTTLSPRFDPHGRASAGPVARPRALLFVLAANMLIDALEVSVVLVALPAIGGDLGLSPQD
AQWMMSGFALGFAALLLSGPRITARWGRRRAYLVALLVFAVASSAGGLVHSGELLVLTRV
IKGMCAALTAPTGLAIIATAYRQGDEQRRAVAVYSFFGAAGFTVGLLASGALTVLSWRWD
LVLPAPIALGLMVLGFCLIPDDRGPAPTASPGTGVTRFLRHGPLVRSALCAASLNGAYLG
LLLLVTYQLHTGPGWNSWQTAVALLPACVPLMVSLPFAGRMVGRLGAARLIVSGTLAATL
GCAGCAVWGVSGSYATGALPALLLVEAGFVLSFAALNMQAVAGIAPESRQTAVSLYQTAV
QLGAALTLPAVALLLGSGGEGPYRTALLLITAVAAVGAAVACTGTRRKAEQPCVSRR
selected fasta
>putative major facilitator superfamily transporter [transporter]
ATGACGACTCTTTCCCCGCGCTTCGATCCGCACGGCCGCGCCTCGGCGGGACCGGTCGCA
CGGCCGCGGGCACTGCTGTTCGTGCTCGCGGCGAACATGCTCATCGACGCCCTGGAGGTC
TCGGTGGTGCTGGTCGCGCTGCCGGCCATCGGCGGCGATCTCGGCCTGTCACCCCAGGAC
GCCCAGTGGATGATGAGCGGCTTCGCACTCGGCTTCGCGGCACTGCTCCTGTCCGGCCCG
CGCATCACGGCACGGTGGGGGCGACGCCGTGCCTACCTGGTGGCGCTCCTCGTCTTCGCT
GTCGCATCCTCGGCAGGCGGATTGGTGCACAGCGGGGAGCTGCTCGTGCTCACCCGCGTC
ATCAAGGGCATGTGCGCCGCGCTCACCGCTCCGACCGGCCTCGCGATCATCGCCACCGCC
TACCGGCAGGGCGACGAGCAGCGCAGGGCGGTGGCGGTGTACTCGTTCTTCGGGGCCGCC
GGTTTCACCGTCGGTCTGCTGGCCTCGGGCGCACTCACCGTGCTGAGCTGGCGTTGGGAC
CTCGTCCTCCCGGCCCCGATCGCCCTGGGGCTGATGGTTCTGGGCTTCTGTCTCATCCCC
GACGACCGCGGGCCGGCGCCGACGGCTTCCCCCGGTACGGGGGTGACTCGATTCCTGCGG
CACGGCCCACTCGTGCGGTCGGCTCTGTGCGCGGCCAGCCTCAACGGTGCCTATCTCGGG
CTTCTCCTGCTGGTCACCTACCAACTGCACACGGGACCGGGCTGGAACTCCTGGCAGACG
GCGGTGGCTCTGCTGCCGGCCTGCGTGCCGCTGATGGTCTCGCTGCCCTTCGCCGGACGC
ATGGTGGGGCGCCTGGGCGCCGCCCGGCTGATCGTCTCGGGCACCCTCGCGGCCACGCTC
GGCTGCGCGGGCTGTGCCGTATGGGGTGTGTCCGGGTCGTACGCCACCGGTGCGCTGCCG
GCCCTGTTGCTCGTCGAGGCGGGATTCGTGCTGTCCTTCGCCGCTCTGAACATGCAGGCC
GTCGCCGGGATCGCACCGGAGTCACGGCAGACGGCGGTGTCCCTCTACCAGACGGCGGTG
CAACTCGGCGCCGCGCTGACGCTGCCGGCGGTCGCTCTGCTGCTGGGCAGCGGCGGCGAG
GGCCCCTACCGGACCGCCCTGCTCCTCATCACCGCCGTCGCCGCCGTCGGCGCCGCAGTC
GCCTGCACCGGGACGAGAAGAAAGGCGGAACAGCCATGCGTATCGAGGAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [32-366]  1.09999999999999e-44 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-412]  8.5000302480906e-55 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [25-409]  PS50850
PS50850   MFS
SignalP
 [1-37]  0.886 Signal
Eukaryota   
TMHMM
 [25-47]  Transmembrane (i-o) [62-84]  Transmembrane (o-i) [91-110]  Transmembrane (i-o) [115-137]  Transmembrane (o-i) [150-172]  Transmembrane (i-o) [182-199]  Transmembrane (o-i) [224-246]  Transmembrane (i-o) [261-283]  Transmembrane (o-i) [290-312]  Transmembrane (i-o) [322-344]  Transmembrane (o-i) [353-375]  Transmembrane (i-o) [385-404]  Transmembrane (o-i)
Transmembrane 12