close all open/close all

CDS information : Urd_00190


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction21,670 / 22,293 / + [in whole cluster]
4,180 / 4,803 / + [in contig]
Location21670..22293 [in whole cluster]
4180..4803 [in contig]
TypeCDS
Length624 bp (207 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)epimerase
Gene
Gene (GenBank)urdZ1
EC number5.1.3.-
Keyword
  • L-rhodinose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • UrdZ1
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
Related Reference
ACC
Q331R1
PmId
[15049360] Cloning, expression, and biological function of a dTDP-deoxyglucose epimerase (gerF) gene from Streptomyces sp. GERI-155. (Biotechnol Lett. , 2004)
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [epimerase]
MRIEEMSIPGAFLITPDQLSDERGAFYELRCDMLERAVGVPFQPQQINYSVSKRHTLRGI
HSVSIPPGQAKLVTCVRGALRDIVVDLRIGSPAFGAHQVTELDAVSGRSVYVPEVWGTDS
SRSPTTPVSATSSPSTYVPGTQIDINPLDPDLDLPWDCPQEPLISEKDAKASSLAEALAS
GTLPDLHDCRTSDAARTALVRAPSERQ
selected fasta
>putative NDP-hexose epimerase [epimerase]
ATGCGTATCGAGGAGATGAGCATCCCCGGTGCCTTCCTGATCACGCCGGATCAACTGTCC
GACGAGCGGGGTGCGTTCTACGAGCTGCGCTGCGACATGCTGGAGCGGGCCGTCGGCGTT
CCCTTCCAGCCCCAGCAGATCAACTACTCGGTCTCCAAGCGGCACACCCTGCGCGGCATC
CACAGCGTCAGCATCCCGCCCGGGCAGGCGAAGCTCGTCACCTGCGTGCGGGGAGCGCTG
CGCGACATCGTGGTCGACCTGCGGATCGGCTCTCCGGCCTTCGGCGCCCACCAGGTGACC
GAGCTGGACGCCGTCTCCGGTCGGTCCGTCTACGTACCCGAAGTGTGGGGCACGGATTCC
TCGCGCTCACCGACGACGCCTGTATCTGCTACGTCGTCTCCCAGCACCTACGTGCCAGGA
ACCCAGATCGACATCAATCCGCTCGATCCGGATCTCGACCTGCCCTGGGACTGTCCGCAG
GAACCGCTCATATCGGAGAAGGACGCGAAGGCGTCCAGCCTGGCCGAGGCACTGGCATCC
GGCACTCTGCCCGACCTGCACGACTGCCGAACCAGCGACGCCGCGCGCACAGCACTCGTC
CGTGCGCCATCCGAAAGGCAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [4-176]  9.3e-34 PF00908
PF00908   dTDP_sugar_isom
 [7-164]  4e-69 PD001462
PD001462   Q9RPA8_STRFR_Q9RPA8;
IPR011051 RmlC-like cupin domain (Domain)
 [1-181]  8.3e-53 SSF51182
SSF51182   RmlC-like cupins
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-189]  1.4e-42 G3DSA:2.60.120.10
G3DSA:2.60.120.10   no description
SignalP No significant hit
TMHMM No significant hit