close all open/close all

CDS information : Urd_00200


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction22,297 / 23,433 / + [in whole cluster]
4,807 / 5,943 / + [in contig]
Location22297..23433 [in whole cluster]
4807..5943 [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductC-glycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)urdGT2
EC number
Keyword
  • C-9 trisaccharide
  • 1st D-olivose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • UrdGT2; uses GTG start codon
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
[12696864] The C-Glycosyltransferase UrdGT2 is unselective toward d- and l-configured nucleotide-bound rhodinoses. (J Am Chem Soc. , 2003)
[17640665] Structure and action of the C-C bond-forming glycosyltransferase UrdGT2 involved in the biosynthesis of the antibiotic urdamycin. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>C-glycosyltransferase [glycosyl transferase]
MRILFVAAGSPATVFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRH
FITTDREGRPEAIPSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVA
PLLALHLGVPHARQTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRP
ANAAPARMMRHVATSRQCPLEPWMYTRDTRQRVLVTSGSRVAKESYDRNFDFLRGLAKDL
VRWDVELIVAAPDTVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGE
PQLLIPKGSVLEAPARRVADYGAAIALLPGEDSTEAIADSCQELHAKDTYARRAQDLSRE
ISGMPLPATVVTALEQLA
selected fasta
>C-glycosyltransferase [glycosyl transferase]
GTGAGAATCCTCTTCGTCGCCGCGGGAAGTCCGGCGACCGTGTTCGCGCTGGCCCCGCTG
GCCACCGCCGCCCGCAACGCCGGCCACCAGGTCGTCATGGCGGCCAACCAGGACATGGGA
CCGGTCGTTACCGGAGTGGGCCTGCCGGCGGTCGCGACCACCGACCTGCCGATCCGCCAC
TTCATCACCACGGACCGGGAGGGCCGTCCCGAGGCCATCCCTTCCGATCCCGTGGCACAG
GCACGTTTCACCGGCCGCTGGTTCGCCCGCATGGCCGCCTCCAGCCTGCCGCGCATGCTG
GACTTCAGCCGTGCCTGGCGTCCCGACCTCATCGTCGGCGGCACGATGAGCTACGTCGCG
CCCCTGCTCGCCCTGCATCTGGGCGTGCCGCACGCCCGCCAGACATGGGATGCTGTCGAT
GCCGACGGCATCCACCCCGGTGCCGATGCCGAACTTCGGCCCGAGCTGAGTGAACTGGGT
CTGGAACGGCTGCCCGCCCCGGATCTGTTCATCGACATCTGCCCGCCGAGCCTGCGCCCC
GCGAACGCCGCGCCCGCCCGGATGATGCGGCACGTCGCGACGAGCCGACAGTGCCCGCTG
GAACCGTGGATGTACACCCGCGACACCCGTCAGCGTGTTCTCGTAACCTCCGGCAGCAGG
GTCGCGAAGGAGAGCTACGACAGGAACTTCGACTTCCTGCGCGGCCTGGCCAAGGATCTC
GTCCGCTGGGATGTCGAGCTCATCGTCGCCGCCCCTGACACCGTCGCCGAGGCCCTCCGC
GCCGAGGTGCCGCAGGCACGGGTCGGCTGGACACCCCTGGATGTCGTGGCGCCCACCTGC
GACCTGCTGGTCCACCATGCGGGCGGTGTCAGCACACTGACCGGCCTGAGCGCGGGTGAG
CCGCAACTGCTCATCCCCAAGGGCTCCGTCCTGGAGGCGCCGGCTCGCCGCGTCGCCGAC
TACGGAGCGGCCATCGCCCTGCTGCCGGGTGAGGACTCGACCGAGGCGATCGCGGACTCC
TGCCAGGAGCTGCACGCCAAGGACACCTATGCCCGGCGAGCCCAGGACCTCTCCCGGGAG
ATCTCCGGAATGCCCCTGCCCGCGACCGTCGTCACAGCGCTCGAACAGCTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-145]  1.4e-09 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-265]  1.1e-15 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.997 Signal
Eukaryota   
 [1-23]  0.998 Signal
Bacteria, Gram-negative   
 [1-34]  0.999 Signal
Bacteria, Gram-positive   
TMHMM No significant hit