close all open/close all

CDS information : Urd_00210


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction23,458 / 24,525 / + [in whole cluster]
5,968 / 7,035 / + [in contig]
Location23458..24525 [in whole cluster]
5968..7035 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)dNDP-glucose synthetase
Gene
Gene (GenBank)urdG
EC number2.7.7.24
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
  • UrdG
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dNDP-glucose synthetase]
MKALVLAGGSGTRLRPFSYSMPKQLIPIANTPVLVHVLRNLRELGVTEAGVIVGNRGPEI
SAVLGDGAEFGMRVTYIPQDAPRGLAHTVAITRDFLCDDDFVMYLGDNMLPDGVVDMRGG
IHRPSAGGQVVVYKVPDPRSFGVAELGPQGEVLRLVEKPRDPRSDMALVGVYFFTAAIHD
AVAAIEPSARGELEITDAIQWLVSSGADVRASQYDGYWKDTGNVEDVLECNRHLLDGLGA
RMDGTVDAASVLTGEVVIEPGAKVVRSRIMGAAIIGAGTVVQDSHVGPHASIGRRCTVTD
SRVENSIALDEASVTGVRGLRNSLIGRSASVGGTGQENERYRLVVGDHTRVEVAA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dNDP-glucose synthetase]
ATGAAGGCACTTGTGCTGGCGGGCGGATCTGGCACCCGCCTGCGGCCCTTCAGCTATTCG
ATGCCCAAACAACTCATCCCCATCGCCAACACGCCCGTGCTGGTGCACGTGCTGCGGAAC
CTCCGCGAGCTGGGAGTCACCGAGGCCGGTGTCATCGTCGGCAACCGGGGCCCGGAGATC
AGCGCCGTCCTCGGCGACGGAGCGGAGTTCGGCATGCGCGTCACCTACATACCCCAGGAT
GCGCCGCGTGGTCTGGCCCATACCGTGGCCATCACCCGCGACTTCCTCTGCGACGACGAT
TTCGTGATGTACCTCGGCGACAACATGCTGCCGGACGGTGTCGTCGACATGCGCGGAGGA
ATTCACCGCCCATCGGCCGGCGGCCAGGTGGTCGTGTACAAGGTCCCGGACCCGCGCTCC
TTCGGCGTCGCCGAACTGGGGCCGCAGGGTGAGGTGCTTCGCCTGGTGGAGAAGCCCCGC
GACCCGCGCAGCGACATGGCGCTGGTCGGCGTGTACTTCTTCACCGCGGCCATCCACGAC
GCCGTCGCCGCGATCGAGCCCAGCGCCCGGGGCGAACTGGAGATCACCGACGCCATCCAG
TGGCTGGTCTCCTCCGGCGCGGACGTGCGCGCCAGCCAGTACGACGGCTACTGGAAGGAC
ACCGGCAACGTCGAGGACGTCCTGGAGTGCAATCGGCACCTCCTCGACGGGCTGGGGGCG
CGCATGGACGGCACCGTCGACGCCGCCAGTGTGCTGACCGGTGAGGTGGTGATCGAACCC
GGGGCGAAGGTCGTGCGCTCCCGCATCATGGGGGCGGCCATCATCGGCGCGGGCACCGTC
GTGCAGGACAGCCACGTGGGTCCGCACGCCTCCATCGGACGACGCTGCACGGTCACGGAC
AGCCGGGTGGAGAACTCCATAGCCCTCGACGAGGCGTCGGTCACTGGCGTCCGAGGACTG
CGCAACTCGCTCATCGGGCGCTCGGCGTCCGTCGGCGGCACCGGCCAGGAGAACGAGCGT
TACCGCCTGGTCGTCGGAGACCACACCCGAGTGGAGGTCGCAGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  2.1e-50 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  1.29999999999998e-116 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit