close all open/close all

CDS information : Urd_00220


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction24,522 / 25,508 / + [in whole cluster]
7,032 / 8,018 / + [in contig]
Location24522..25508 [in whole cluster]
7032..8018 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)dNDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)urdH
EC number4.2.1.46
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
  • UrdH
Reference
ACC
PmId
[10658661] Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717. (Microbiology. , 2000)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [dNDP-glucose 4,6-dehydratase]
MNILVTGAAGFIGSHFVRSLLADTYSGWEGARVTALDKLTYAGNRNNLPPSNPRLEFVRG
DVCDRALLRELLPGHHAVVHFAAESHVDRSLEGAGEFFRTNVLGTQTLLDAVLDSGVERV
VHVSTDEVYGSIEQGSWTEDWPLQPNSPYAASKACSDLVARAYCAPTEVDLSITRCSNNY
GPHQHPEKVIPRFVTNLLEGRQVPLYGDGRNVREWLHVEDHCRGIHLVLNKGQAGEIYNI
GGGNEYTNLALTEKLLELTGAGPEMIRRVPDRKAHDLRYSIDESKIREKLGYAPRISFEQ
GLSDTVAWYRDNPDWWKSIEHGGDSAAA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [dNDP-glucose 4,6-dehydratase]
ATGAACATCCTGGTCACCGGCGCGGCCGGTTTCATCGGCTCGCACTTCGTCCGCAGCCTG
CTGGCCGACACCTACTCCGGCTGGGAGGGAGCCCGGGTCACTGCCCTGGACAAACTGACC
TACGCGGGCAACCGGAACAACCTGCCGCCCTCAAACCCGCGCCTGGAGTTCGTGCGGGGC
GACGTGTGCGACCGCGCCCTGCTCCGCGAGCTGCTGCCCGGGCACCACGCCGTGGTCCAT
TTCGCGGCGGAATCCCACGTGGACCGCTCCCTCGAAGGCGCGGGCGAGTTCTTCCGCACG
AACGTCCTCGGTACGCAGACACTCCTCGACGCCGTACTGGACAGCGGAGTCGAGCGGGTC
GTTCACGTCTCCACCGACGAGGTGTACGGCTCGATCGAGCAAGGCTCCTGGACCGAGGAC
TGGCCGCTGCAGCCCAATTCTCCGTACGCCGCCTCGAAGGCATGCTCGGACCTGGTCGCG
CGAGCCTACTGCGCACCCACGGAGGTGGACCTCTCCATCACCCGCTGCTCCAACAACTAC
GGCCCGCACCAGCACCCTGAGAAGGTCATTCCCAGGTTCGTCACGAACCTCCTCGAAGGA
CGCCAGGTCCCGCTGTACGGCGACGGCCGCAATGTGCGCGAGTGGCTCCACGTGGAGGAC
CACTGCCGCGGTATCCACCTGGTGCTCAACAAGGGGCAGGCCGGCGAGATCTACAACATC
GGCGGGGGCAACGAGTACACCAACCTCGCCCTCACCGAGAAACTGCTCGAACTGACGGGT
GCCGGCCCGGAGATGATCCGCCGCGTCCCCGACCGCAAGGCGCACGACCTGCGGTACTCG
ATCGACGAGTCCAAGATCCGCGAGAAGCTCGGCTACGCCCCGCGGATCAGCTTCGAACAG
GGCCTGTCCGACACCGTCGCCTGGTACCGCGACAACCCGGACTGGTGGAAGAGCATCGAG
CATGGCGGGGACAGTGCGGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  9.9e-70 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-319]  5.20000000000001e-122 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-188]  3.19999999999996e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.893 Signal
Bacteria, Gram-negative   
 [1-22]  0.221 Signal
Bacteria, Gram-positive   
 [1-22]  0.772 Signal
Eukaryota   
TMHMM No significant hit