close all open/close all

CDS information : Urd_00230


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction25,534 / 26,574 / + [in whole cluster]
26 / 1,066 / + [in contig]
Location25534..26574 [in whole cluster]
26..1066 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-hexose 4-ketoreductase UrdZ3
Gene
Gene (GenBank)urdZ3
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-ketoreductase UrdZ3]
MVVLGSGGFLGRHIGDAFAAQGARVHAVTRNSSDRTPHGAATGSRTTPIDLLTTPPQEVA
EFLGSVGADVVVNAAGRAWRADEAQMTAGNAELVLRLVTALEQVPGPPIRLVQLGSVHEY
GAGAPNTGTGEEHEPTPVTAYGRTKLLGTQTVLRAAQDRTVEGVVLRLANVIGAGVPEGS
LFGRVAAHLAAAARAESRGEKAAELRLPPLAAARDVVDARDAADAVVAAATTVGVAGRVI
NVGRGEAVGTRELIDRMVRLSGLAVPVVEETAAAMSRTDVDWQRLDVSRARRLLGWRPRR
SLDASLRDLLAAALPSSSTRLGGVPDVASRRAPLDAPTTAPVDERK
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-ketoreductase UrdZ3]
ATGGTCGTCCTGGGAAGCGGCGGTTTTCTGGGGCGCCACATCGGCGACGCCTTCGCCGCG
CAGGGAGCGCGGGTGCACGCCGTGACCCGGAACAGCTCGGACCGTACTCCCCACGGCGCC
GCGACCGGGTCCCGCACGACACCCATCGACCTGCTGACGACCCCACCGCAGGAGGTCGCC
GAGTTCCTCGGCTCGGTCGGCGCCGATGTCGTCGTCAACGCCGCCGGCCGGGCCTGGCGG
GCCGACGAGGCCCAGATGACCGCGGGCAACGCCGAACTGGTCCTGCGCCTCGTCACCGCC
CTCGAGCAAGTGCCCGGCCCGCCGATCCGGCTGGTGCAGCTCGGCAGCGTCCACGAGTAC
GGGGCGGGCGCGCCGAACACCGGCACCGGTGAGGAGCACGAGCCCACCCCGGTGACCGCC
TACGGACGCACCAAGCTCCTCGGGACGCAGACCGTCCTGCGCGCCGCGCAGGACCGCACT
GTCGAGGGCGTCGTGCTCCGGCTCGCCAACGTCATCGGTGCGGGCGTTCCGGAGGGCAGC
CTGTTCGGCAGGGTCGCCGCGCACCTCGCGGCGGCCGCGCGCGCCGAGTCCCGGGGGGAG
AAGGCCGCCGAGCTGCGCCTTCCGCCACTGGCCGCGGCGCGCGACGTCGTCGACGCGCGT
GACGCCGCCGACGCGGTGGTGGCCGCCGCCACCACGGTCGGTGTCGCCGGACGGGTGATC
AACGTGGGGCGCGGCGAGGCGGTCGGGACACGCGAGCTGATCGACCGGATGGTCCGGCTC
AGCGGCCTGGCCGTCCCGGTCGTGGAAGAGACCGCCGCGGCGATGTCACGCACGGACGTG
GACTGGCAGCGGCTGGATGTGTCCCGCGCGCGTCGGCTGCTGGGCTGGCGGCCGCGCCGC
AGCCTCGATGCCTCGCTGCGCGACCTTCTCGCGGCGGCCCTGCCGTCATCCTCGACACGC
CTCGGCGGCGTCCCGGACGTCGCATCCCGCCGCGCACCACTCGACGCTCCGACCACCGCG
CCGGTTGACGAAAGGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [1-243]  1.8e-30 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-176]  1.9e-30 G3DSA:3.40.50.720 [214-251]  1.9e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-19]  0.274 Signal
Bacteria, Gram-negative   
 [1-19]  0.189 Signal
Bacteria, Gram-positive   
TMHMM No significant hit