close all open/close all

CDS information : Urd_00240


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction26,577 / 27,881 / + [in whole cluster]
1,069 / 2,373 / + [in contig]
Location26577..27881 [in whole cluster]
1069..2373 [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)NDP-hexose 3,4-dehydratase UrdQ
Gene
Gene (GenBank)urdQ
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[17434221] Surprising production of a new urdamycin derivative by S. fradiae Delta urdQ/R. (J Biotechnol. , 2007)
Related Reference
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose 3,4-dehydratase UrdQ]
MGDRKELVLEEVRTYHRDVSPDQEFIPGTTEIWPSGAVLDESDRVALVEAALDMRIAAGT
SSRKFESAFARRLKRRKAHLTNSGSSANLLAVSALTSHVLEDRRLRPGDEVITVAAGFPT
TVNPILQNGLVPVFVDVDLPTYNATAERVAQAIGPKTRAIIIAHALGNPFEVAEMAQLAE
EHDLFLIEDNCDAVGSTYDGQLTGTFGDLTTVSFYPAHHLTMGEGGCVLTSNLSLARIVE
SLRDWGRDCWCEPGENDRCLKRFKYQMGTLPAGYDHKYIFSHVGYNLKATDIQAALGLTQ
LAKLDDFIEARQRNWRRLREGLDGVPGLLLPEPTPRSQPSWFGFVITVAPDAPFSRAELV
DFLEDRKIGTRRLFAGNLTRHPAYIDQPHRIVGELTNSDLVTEQTFWIGVYPALTDEMLD
YVTASIKEFVAARG
selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose 3,4-dehydratase UrdQ]
ATGGGTGACCGCAAGGAACTGGTGCTGGAAGAGGTCCGCACGTATCACCGGGATGTCTCG
CCCGACCAGGAGTTCATCCCGGGAACCACCGAGATCTGGCCGTCCGGCGCGGTGCTGGAC
GAGTCCGACCGCGTGGCCTTGGTCGAGGCCGCCCTCGACATGCGCATCGCCGCGGGAACG
AGTTCCCGGAAGTTCGAATCCGCCTTTGCTCGACGGCTCAAGCGGCGCAAGGCCCATCTC
ACCAACTCCGGTTCGTCCGCGAACCTGCTCGCCGTGTCGGCACTCACCTCGCACGTCCTG
GAGGATCGAAGGCTGAGGCCGGGCGACGAGGTGATCACGGTGGCCGCCGGCTTCCCCACC
ACCGTGAACCCGATCCTGCAGAACGGCCTGGTCCCGGTGTTCGTGGACGTGGACCTTCCC
ACCTACAACGCCACCGCCGAGCGGGTGGCCCAGGCGATCGGCCCCAAGACCCGGGCGATC
ATCATCGCCCATGCGCTGGGCAACCCGTTCGAGGTGGCCGAGATGGCCCAGCTCGCCGAG
GAGCACGACCTGTTCCTGATCGAGGACAACTGCGACGCGGTGGGCTCCACCTACGACGGA
CAGCTCACGGGCACCTTCGGCGACCTGACCACGGTCAGTTTCTATCCGGCGCACCATCTG
ACCATGGGGGAGGGCGGGTGCGTCCTGACCTCCAACCTCAGCCTCGCCCGCATCGTGGAG
TCACTGCGTGACTGGGGCCGGGACTGCTGGTGCGAACCGGGCGAGAACGACAGGTGCCTC
AAGCGCTTCAAGTACCAGATGGGCACCCTCCCCGCCGGATACGACCACAAGTACATTTTC
TCGCACGTCGGTTACAACCTGAAGGCCACCGACATACAGGCGGCCCTCGGCCTGACGCAG
CTCGCCAAGCTGGACGACTTCATCGAAGCCCGTCAGCGCAACTGGCGTCGTCTGCGCGAA
GGGCTCGACGGCGTACCGGGCCTGCTGTTGCCGGAGCCCACGCCGCGTTCCCAGCCGAGC
TGGTTCGGCTTCGTGATCACCGTCGCCCCCGACGCACCCTTCAGCCGGGCCGAGTTGGTC
GACTTCCTGGAGGACCGGAAGATCGGCACTCGACGCTTGTTCGCCGGCAACCTCACCAGG
CACCCGGCCTACATCGACCAGCCGCACCGCATCGTCGGCGAGCTCACCAACAGCGACCTC
GTCACCGAGCAGACCTTCTGGATCGGCGTCTATCCCGCGCTCACCGACGAAATGCTCGAT
TACGTGACCGCCTCGATCAAGGAGTTCGTCGCCGCACGTGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-434]  2.39999798157263e-112 PIRSF000390
PIRSF000390   PLP_StrS
 [43-426]  1.29999999999998e-99 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [32-302]  4.40000000000003e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [303-427]  2.29999999999998e-50 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [29-433]  2.2999842048857e-96 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit