close all open/close all

CDS information : Urd_00250


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction27,922 / 28,665 / + [in whole cluster]
2,414 / 3,157 / + [in contig]
Location27922..28665 [in whole cluster]
2414..3157 [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-hexose 4-ketoreductase UrdR
Gene
Gene (GenBank)urdR
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
Reference
ACC
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[17434221] Surprising production of a new urdamycin derivative by S. fradiae Delta urdQ/R. (J Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-ketoreductase UrdR]
MDIVGNGFLARNLRPLAERHPDTVALAAGVSWASGTSDADFAREAALLRDTAKQCAATGR
RLLFFSTAATGMYGLAEGPGREDTPVTPCTPYGAHKLALEELLRDSGADHVILRLGHLVG
PDQPEHQLLPTLVRHLREGAVRIHRGAARDLIDVSDVVTIVDCLLGLDLKAETVNVASGY
AVPVKDIVELLRRRLGVEARYEFQDAGGQHVISIEKLRALVPQVQDMGFGPDYYRRILSD
FTSAVRI
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-ketoreductase UrdR]
ATGGACATTGTGGGAAATGGATTCCTGGCGCGGAACCTGCGGCCGCTGGCCGAACGGCAT
CCCGATACCGTGGCCCTCGCCGCCGGTGTCTCATGGGCGAGCGGTACCTCCGATGCCGAC
TTCGCCCGGGAAGCCGCACTCCTGCGAGACACCGCCAAGCAGTGCGCGGCCACCGGACGA
CGACTGCTGTTCTTCTCGACCGCTGCCACGGGCATGTACGGCCTGGCGGAGGGACCCGGC
CGAGAGGACACGCCAGTGACGCCGTGCACCCCGTACGGCGCGCACAAGCTGGCGCTGGAG
GAACTGCTGCGGGACTCCGGTGCCGACCATGTGATTCTCAGGCTCGGGCACCTCGTGGGG
CCCGACCAGCCCGAGCACCAACTGCTGCCCACGCTGGTGCGTCACCTACGCGAAGGCGCG
GTGCGCATTCACCGAGGCGCGGCCCGTGACCTCATCGACGTCAGCGACGTCGTCACCATT
GTCGACTGCCTTCTCGGCCTTGACCTCAAGGCCGAGACGGTCAACGTGGCCTCCGGCTAC
GCCGTTCCGGTGAAGGACATCGTCGAACTCCTGCGCCGCAGGCTCGGGGTCGAGGCGCGG
TACGAGTTCCAGGATGCCGGTGGTCAGCACGTCATCTCCATCGAGAAGCTGCGCGCACTC
GTTCCGCAGGTCCAGGACATGGGCTTCGGGCCCGACTACTACCGGCGGATCCTCAGTGAC
TTCACCTCCGCCGTCCGTATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [16-177]  4.5e-21 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [14-194]  2.1e-21 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-27]  0.224 Signal
Bacteria, Gram-positive   
 [1-33]  0.22 Signal
Bacteria, Gram-negative   
TMHMM No significant hit