close all open/close all

CDS information : Urd_00260


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction28,704 / 30,113 / + [in whole cluster]
3,196 / 4,605 / + [in contig]
Location28704..30113 [in whole cluster]
3196..4605 [in contig]
TypeCDS
Length1,410 bp (469 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-hexose 2,3-dehydratase UrdS
Gene
Gene (GenBank)urdS
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase UrdS]
MLSESLLAVAQPRAADNTCDRIGLSAATADGRHLRTSDFGDWLAGRGRANEFRVDRVPFA
ALDGWAFDEATGNLVHRSGRFFTVEGLHVTELDAPYGDGPYADWHQPIIKQPEVGILGIL
VKEFDGVLHFLMQAKMEPGNPNLLQLSPTVQATRSNYTKAHHGADVKYIEHFVGPTRGHI
IADVLQSEHGSWFYRKSNRNMIVEAVGDVPLHDDFCWLTLGQISTLMHQDNVVNMDSRTV
LSCLPYADTRSRALLSDTQLLSWITEERSRHDVRVERVPLGSLPGWRRGESTIEHEAGRY
FKVVAVAVQAGSREVTGWTQPLFEPVGLGVTAFLTRAFDGVPHVLVHARVEAGFLDTIEL
GPTVQYTPGNYAHLDEKNRPLFLDTVLRAPSDRIRYEAVHSEEGGRFLNAESRYLIVDTD
ETEAPQNPPSGYAWVTPAQLTSLVRHGHYVNVQGRTLLACLNAMAVNSR
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase UrdS]
ATGCTTTCTGAAAGCCTTCTCGCAGTGGCCCAGCCGCGTGCGGCCGACAACACCTGTGAT
CGCATCGGGCTGTCCGCAGCGACCGCCGACGGTAGGCACCTGCGCACGTCGGATTTCGGG
GACTGGCTGGCCGGACGCGGCCGGGCCAACGAGTTCCGGGTGGACCGCGTACCGTTCGCC
GCACTGGACGGCTGGGCCTTCGACGAGGCCACCGGCAATCTGGTGCACCGCAGCGGCCGG
TTCTTCACAGTTGAGGGCCTGCACGTCACCGAGCTGGACGCCCCCTACGGCGACGGCCCC
TATGCCGACTGGCACCAGCCCATCATCAAGCAGCCCGAGGTGGGCATCCTGGGCATCCTG
GTCAAGGAGTTCGACGGGGTACTGCATTTTCTCATGCAGGCAAAGATGGAGCCGGGCAAT
CCGAACCTGCTCCAACTCTCGCCCACGGTTCAGGCCACTCGCAGCAACTACACCAAGGCC
CACCACGGAGCCGACGTGAAGTACATCGAGCACTTCGTCGGTCCGACGCGCGGTCACATC
ATCGCGGACGTACTGCAGTCGGAACACGGCTCGTGGTTCTACCGAAAGTCCAACCGCAAC
ATGATCGTGGAAGCCGTCGGCGACGTGCCGCTGCACGACGACTTCTGCTGGCTCACCCTC
GGCCAGATCAGCACGCTGATGCACCAGGACAACGTGGTCAACATGGACTCGCGTACCGTC
CTGTCCTGCCTGCCCTACGCGGACACCCGTTCGCGCGCGCTGCTCTCCGACACCCAGTTG
CTCTCCTGGATCACCGAGGAGCGATCGCGACACGATGTGCGGGTTGAGCGGGTCCCGCTC
GGGAGCCTCCCGGGGTGGCGACGCGGTGAGAGCACGATCGAGCACGAAGCGGGCCGGTAC
TTCAAGGTCGTGGCCGTGGCCGTGCAGGCCGGCAGCCGTGAGGTGACCGGCTGGACCCAG
CCCCTCTTCGAGCCGGTCGGCCTGGGCGTCACGGCCTTCCTCACCCGCGCATTCGATGGC
GTTCCGCACGTGCTGGTTCACGCCCGGGTCGAGGCCGGTTTCCTCGACACCATCGAGCTG
GGCCCGACCGTCCAGTACACCCCGGGCAATTACGCCCACCTGGACGAGAAGAACCGGCCG
CTCTTCCTCGACACCGTGCTGCGTGCCCCGTCGGATCGCATCCGCTACGAGGCCGTGCAC
TCGGAGGAGGGCGGTCGCTTCCTCAACGCCGAGAGCCGCTACCTGATCGTCGACACCGAC
GAGACGGAGGCCCCGCAGAACCCGCCGTCGGGCTACGCCTGGGTCACACCGGCACAACTG
ACCTCGCTGGTGCGACACGGCCATTACGTCAATGTCCAGGGCCGCACTCTGCTGGCCTGC
CTCAACGCCATGGCGGTGAACAGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [36-244]  1.99999999999999e-84 PF03559 [256-461]  1.69999999999998e-84 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit