close all open/close all
Urd_00260 Urd_00260   last last

CDS information : Urd_00270


close this sectionLocation

Organism
StrainTü2717
Entry nameUrdamycin
Contig
Start / Stop / Direction30,110 / 30,916 / + [in whole cluster]
4,602 / 5,408 / + [in contig]
Location30110..30916 [in whole cluster]
4602..5408 [in contig]
TypeCDS
Length807 bp (268 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase(fragment)
Product (GenBank)oxidoreductase UrdT
Gene
Gene (GenBank)urdT
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase(fragment) [oxidoreductase UrdT]
MSRPVGIGVIGCADIAVRRMLPAFATGPETEVVAVASRTLGKAERVAERFGCRAVQGYAA
LLELEKVQAVYIPLPAALHAEWVRKAALRGQSTCWPRNPSRPTPLRTEQLLKLARYRGLA
LMENVMFVHHSRHEAVRRLVDEGAIGELRGLQSAFTIPAPADDDIRYAPELGGGALPDVG
VYPLRAALHFLGPGLEVVGAHLASGPGRHVETSGAALLRTPAGVTAQVIFGMEHTYRSTY
YLLGGDGRLTVERAFTPSADFIPVIPVPP
selected fasta
>putative NDP-hexose C-3 ketoreductase(fragment) [oxidoreductase UrdT]
ATGAGCCGACCGGTGGGGATCGGAGTGATCGGCTGTGCCGACATCGCGGTACGCCGGATG
CTCCCTGCTTTCGCAACCGGGCCTGAGACAGAGGTCGTCGCGGTTGCCAGCCGCACCCTG
GGCAAGGCCGAGCGGGTTGCCGAGCGCTTCGGGTGCCGGGCTGTCCAGGGCTACGCCGCG
CTCCTGGAACTGGAGAAGGTGCAGGCCGTGTACATACCGCTGCCTGCCGCTCTGCACGCG
GAGTGGGTCCGAAAGGCTGCGCTGCGCGGGCAAAGCACGTGCTGGCCGAGAAACCCCTCA
CGCCCGACCCCGCTGCGCACTGAGCAGCTGCTGAAGCTGGCCCGGTACCGCGGGCTGGCC
CTGATGGAGAACGTCATGTTCGTCCATCATTCTCGCCATGAGGCGGTTCGGCGGCTGGTC
GACGAGGGCGCGATCGGTGAACTGCGCGGTCTGCAGTCGGCATTCACCATTCCGGCTCCG
GCCGACGACGACATCCGGTACGCCCCGGAGCTCGGCGGCGGCGCGCTCCCGGACGTCGGC
GTCTATCCGCTCCGCGCCGCCTTGCACTTCCTCGGCCCGGGGCTGGAAGTCGTCGGAGCA
CATCTCGCGAGTGGACCCGGCAGACACGTCGAGACCTCGGGCGCGGCCCTGCTGCGTACA
CCTGCGGGCGTCACGGCGCAGGTGATCTTTGGCATGGAGCACACGTACCGCTCCACCTAT
TATCTGTTGGGCGGTGACGGACGGCTCACCGTCGAGCGGGCCTTCACACCGTCGGCCGAC
TTCATTCCCGTGATCCCCGTCCCCCCG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [6-91]  3.8e-14 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [137-240]  2.8e-05 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [1-147]  3.2e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-25]  0.151 Signal
Bacteria, Gram-negative   
 [1-25]  0.235 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
Urd_00260 Urd_00260   last last