close all open/close all
first first   Vanco_00020 Vanco_00020

CDS information : Vanco_00010


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction175 / 1,215 / + [in whole cluster]
175 / 1,215 / + [in contig]
Location175..1215 [in whole cluster]
175..1215 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative D-lactate dehydrogenase
Product (GenBank)D-lactate dehydrogenase
Gene
Gene (GenBank)vanH
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
Related Reference
ACC
O33805
NITE
A4793_00310
PmId
[10387095] Molecular mechanism of VanHst, an alpha-ketoacid dehydrogenase required for glycopeptide antibiotic resistance from a glycopeptide producing organism. (Biochemistry. , 1999)
ACC
Q05709
PmId
[1931965] Molecular basis for vancomycin resistance in Enterococcus faecium BM4147: biosynthesis of a depsipeptide peptidoglycan precursor by vancomycin resistance proteins VanH and VanA. (Biochemistry. , 1991)
[1503450] Evidence for in vivo incorporation of D-lactate into peptidoglycan precursors of vancomycin-resistant enterococci. (Antimicrob Agents Chemother. , 1992)
[9605319] A thioredoxin fusion protein of VanH, a D-lactate dehydrogenase from Enterococcus faecium: cloning, expression, purification, kinetic analysis, and crystallization. (Protein Sci. , 1998)
ACC
R4SKG0
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative D-lactate dehydrogenase [D-lactate dehydrogenase]
MTYSEPAPAADSRTRSLASASSSAVLAMGITIYGCGQDEAALFREMAPRFGVLPTIVDAP
VSEANIDLVAGNRCISVGHKNRITNSTLRALSEAGVVYVSTRSIGFNHIDVDYAASVGIT
VGNVSYSPDSVADFTLMLMLMAIRNAKSIIRRADVHDYRLQDVRGKELRDLTVGVIGTGR
IGVAVLQRLRGFGCEVLAYDKYPQADADYVALDELLRRSDIVTLHAPLDADTHHLLDRHK
IEEMKHGAFVINTGRGALIETEALIAALDSGKLGGAALDVVEGEEGIFYADCSDKAIDSK
PLLRLQELPNVLISPHTAYYTDHALSDTVENSIVNCLKFESGKQHG
selected fasta
>putative D-lactate dehydrogenase [D-lactate dehydrogenase]
ATGACCTACAGCGAACCAGCACCGGCCGCGGACAGCCGCACGCGTTCGCTGGCGTCCGCG
TCCTCCTCGGCCGTCCTGGCAATGGGGATCACGATTTACGGATGCGGACAGGACGAGGCC
GCCTTGTTCCGGGAGATGGCACCCCGTTTCGGTGTGCTGCCCACCATCGTGGACGCGCCG
GTATCCGAGGCCAATATCGATCTGGTGGCCGGAAACCGGTGCATCAGTGTGGGTCACAAG
AATCGAATCACGAACTCCACGCTTCGCGCGCTCAGCGAGGCGGGCGTGGTGTATGTCTCC
ACGAGGAGCATCGGGTTCAACCATATCGACGTGGACTACGCCGCGAGCGTCGGTATCACC
GTCGGAAACGTCTCCTATTCGCCGGACAGTGTCGCCGACTTCACGTTGATGCTGATGCTG
ATGGCGATCCGGAACGCGAAATCCATCATCCGCAGGGCGGATGTGCACGACTACCGGCTG
CAGGACGTACGCGGGAAAGAACTGCGCGATCTGACGGTCGGCGTGATCGGCACCGGGCGC
ATCGGCGTCGCTGTCCTCCAACGACTTCGAGGCTTCGGCTGCGAGGTGCTGGCCTACGAC
AAGTACCCCCAGGCCGACGCCGATTACGTTGCCCTCGACGAATTGCTGCGGCGGAGCGAC
ATCGTCACGCTCCATGCCCCACTCGACGCGGATACCCACCATCTCCTCGATCGTCACAAG
ATCGAGGAGATGAAGCACGGCGCGTTCGTCATCAACACGGGACGCGGTGCGCTGATCGAA
ACCGAGGCCCTCATCGCGGCCTTGGACAGCGGCAAACTGGGCGGTGCGGCGCTCGATGTC
GTCGAAGGAGAGGAAGGGATTTTCTACGCCGACTGCAGCGACAAGGCCATCGACAGCAAG
CCGTTGCTGCGGTTGCAGGAGCTGCCGAACGTGCTCATCAGTCCGCATACCGCCTATTAC
ACGGATCACGCACTGAGTGACACCGTTGAAAACTCTATCGTCAATTGCCTGAAATTTGAA
AGCGGGAAACAGCATGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006139 D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (Domain)
 [37-344]  2.2e-18 PF00389
PF00389   2-Hacid_dh
IPR006140 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding (Domain)
 [244-260]  PS00671
PS00671   D_2_HYDROXYACID_DH_3
 [136-318]  5.4e-54 PF02826
PF02826   2-Hacid_dh_C
 [215-237]  PS00670
PS00670   D_2_HYDROXYACID_DH_2
 [173-200]  PS00065
PS00065   D_2_HYDROXYACID_DH_1
IPR016040 NAD(P)-binding domain (Domain)
 [28-143]  1.5e-23 G3DSA:3.40.50.720 [144-318]  1.4e-55 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit
first first   Vanco_00020 Vanco_00020