close all open/close all

CDS information : Vanco_00030


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction2,245 / 2,853 / + [in whole cluster]
2,245 / 2,853 / + [in contig]
Location2245..2853 [in whole cluster]
2245..2853 [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative D-alanyl-D-alanine dipeptidase
Product (GenBank)dipeptidase
Gene
Gene (GenBank)vanX
EC number3.4.13.22
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q6ZZK1
NITE
Teicp2_00130
PmId
[17220405] Resistance to glycopeptide antibiotics in the teicoplanin producer is mediated by van gene homologue expression directing the synthesis of a modified cell wall peptidoglycan. (Antimicrob Agents Chemother. , 2007)
ACC
Q9ZI81
NITE
A4793_00330
PmId
[9751644] Homologs of the vancomycin resistance D-Ala-D-Ala dipeptidase VanX in Streptomyces toyocaensis, Escherichia coli and Synechocystis: attributes of catalytic efficiency, stereoselectivity and regulation with implications for function. (Chem Biol. , 1998)
ACC
R4SV78
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative D-alanyl-D-alanine dipeptidase [dipeptidase]
MKDDFVYVDEVVPGIRWDAKYATWDNFTGKPVDGYLVNRIVGTKALCAALEKARDKAESL
GFGLLLWDGYRPQRAVNRFMSWAEEPEDGRKKSRHYPNIDRPQMFEKGYVATKSGHSRGS
TVDLTIYHLATGELAPMGGDHDLMDVVSHHGAEGVTPEEAKNRLHLRAIMEDCGFNSYEY
EWWHYNLKDEPYPDTYFDFPIE
selected fasta
>putative D-alanyl-D-alanine dipeptidase [dipeptidase]
ATGAAGGATGATTTCGTCTACGTAGACGAGGTCGTGCCCGGAATCCGCTGGGACGCCAAG
TACGCCACCTGGGACAACTTCACCGGCAAGCCGGTGGACGGGTACCTCGTGAATCGGATC
GTCGGCACCAAGGCGCTGTGCGCGGCCCTGGAAAAGGCGAGGGACAAGGCCGAGTCTCTC
GGCTTCGGCCTGCTCCTCTGGGACGGTTACCGTCCTCAGCGTGCCGTGAACCGCTTCATG
AGCTGGGCGGAAGAGCCCGAGGACGGCCGGAAGAAGTCCCGGCACTACCCGAACATCGAC
CGGCCCCAGATGTTCGAAAAGGGCTACGTGGCGACGAAGTCGGGGCACAGCCGGGGAAGC
ACGGTGGACCTGACGATCTACCACCTGGCCACCGGCGAACTCGCCCCGATGGGCGGCGAC
CACGACCTGATGGACGTCGTCTCGCATCATGGCGCCGAGGGGGTCACGCCGGAAGAGGCG
AAGAACCGCCTGCACCTCCGCGCCATCATGGAGGACTGCGGCTTCAACTCGTACGAGTAC
GAGTGGTGGCACTACAACCTGAAGGACGAGCCTTACCCGGACACCTACTTCGACTTCCCG
ATCGAATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000755 Peptidase M15D, VanX D-ala-D-ala dipeptidase (Family)
 [1-202]  2.69998997787809e-58 PIRSF026671
PIRSF026671   AA_dipeptidase
 [3-200]  1.29999999999998e-69 PF01427
PF01427   Peptidase_M15
IPR009045 Hedgehog signalling/DD-peptidase zinc-binding domain (Domain)
 [1-202]  1.39999277195148e-70 SSF55166
SSF55166   Hedgehog_sig_N
 [2-201]  1.79999999999997e-66 G3DSA:3.30.1380.10
G3DSA:3.30.1380.10   Hedgehog/DD-pept_Zn-bd
SignalP No significant hit
TMHMM No significant hit