close all open/close all

CDS information : Vanco_00040


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction3,008 / 3,571 / + [in whole cluster]
3,008 / 3,571 / + [in contig]
Location3008..3571 [in whole cluster]
3008..3571 [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative D-alanyl-D-alanine carboxypeptidase
putative DD-carboxypeptidase
Product (GenBank)putative VanY-typeDD-carboxypeptidase
Gene
Gene (GenBank)vanY
EC number3.4.16.4
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q799B4
NITE
Balhi_00030
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)

close this sectionSequence

selected fasta
>putative D-alanyl-D-alanine carboxypeptidase [putative VanY-typeDD-carboxypeptidase]
MISSERVRTTARRIPGLLVSVIRRVRSTLAAGRRGALGKEHGAVPRGTTVFDDRVPGVAN
LDPALLAALRKAAKDAADDGVELFVNSGWRSPEYQTKLRRDAVSKYGSEEEAARWVATPE
RSIHVAGRAADIGPPASAAWLSQHGARYGLCRIYRNEPWHYELRPEAIEHGCPPMYPDPS
HDPRLRD
selected fasta
>putative D-alanyl-D-alanine carboxypeptidase [putative VanY-typeDD-carboxypeptidase]
ATGATCAGCAGCGAACGAGTACGGACCACGGCCCGCCGGATTCCCGGGCTCCTCGTCTCG
GTGATCCGCCGGGTCCGGAGCACCCTCGCGGCCGGGCGGCGTGGCGCGCTCGGCAAGGAG
CACGGAGCCGTCCCCCGCGGCACGACCGTCTTCGACGACAGGGTGCCCGGCGTGGCCAAC
CTCGACCCGGCCCTCCTCGCCGCTCTGCGCAAGGCCGCGAAGGACGCCGCGGACGACGGT
GTCGAGCTGTTCGTCAACAGCGGCTGGCGCTCACCGGAGTATCAGACCAAGCTTCGCCGC
GACGCGGTCTCGAAGTACGGATCCGAAGAGGAAGCCGCCCGGTGGGTCGCCACGCCGGAG
CGGTCCATTCACGTGGCGGGCCGCGCGGCGGACATCGGGCCGCCCGCTTCCGCGGCGTGG
CTGTCCCAGCACGGCGCCCGGTACGGATTGTGCCGGATCTACCGCAACGAACCCTGGCAC
TACGAACTGCGCCCCGAGGCGATCGAGCACGGCTGCCCGCCCATGTACCCCGACCCCAGT
CACGACCCGAGGTTGCGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003709 Peptidase M15B/M15C (Domain)
 [60-164]  2.1e-16 PF02557
PF02557   VanY
IPR009045 Hedgehog signalling/DD-peptidase zinc-binding domain (Domain)
 [52-138]  1.2e-05 G3DSA:3.30.1380.10
G3DSA:3.30.1380.10   Hedgehog/DD-pept_Zn-bd
SignalP No significant hit
TMHMM No significant hit