close all open/close all

CDS information : Vanco_00050


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction4,842 / 5,807 / + [in whole cluster]
4,842 / 5,807 / + [in contig]
Location4842..5807 [in whole cluster]
4842..5807 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)vancomycin transcriptional regulator StrR family
Gene
Gene (GenBank)vtr
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q799B3
NITE
Balhi_00040
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
ACC
Q7WZ87
NITE
A4092_00100
PmId
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
ACC
R4T042
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative transcriptional regulator [vancomycin transcriptional regulator StrR family]
MDPTRVDLSALPIVEIELSRLSSVRSPRTSGEDPEHVEALLSAEWELPPILVHRPTMQVV
DGLHRLKAARVRGDTKIRAKFVDGTESDAFVLAVEANIRHGLPLSLADRKRAAVQIIGTH
PQWSDRRVASATGISAGTVADLRKRGGEGGNEARIGRDGRIRPVDSTERRRLAADLIRND
PGLSLRQVAKQVGISPETVRDVRGRLERGESPTPDGSRRLRTKTHPLSLTESELGHALDR
ERVAVLERLKADPTLRLSEVGRILLRMLAMHSIDGQEWERILRGVPPHLYGVVAGFARDH
ARVWAGFADHLENRATDLAAG
selected fasta
>putative transcriptional regulator [vancomycin transcriptional regulator StrR family]
GTGGATCCGACGAGAGTTGACCTATCCGCTCTCCCGATCGTCGAGATCGAGCTGTCCAGG
CTGTCCTCCGTACGTTCGCCGCGAACCTCGGGCGAGGATCCGGAGCACGTCGAGGCGCTG
TTGTCGGCCGAGTGGGAGCTTCCGCCTATTCTCGTGCACCGTCCAACGATGCAGGTGGTC
GATGGTCTGCACCGGTTGAAGGCGGCGCGCGTCAGGGGCGACACGAAAATCCGCGCCAAG
TTCGTCGACGGCACCGAATCCGATGCCTTCGTCCTGGCCGTGGAAGCGAACATCCGGCAC
GGCCTGCCGCTTTCGCTCGCCGATCGCAAACGGGCGGCCGTCCAGATCATCGGGACGCAT
CCGCAGTGGTCCGATCGGCGGGTGGCCTCGGCGACCGGTATCTCCGCCGGCACGGTGGCG
GATCTGCGCAAACGTGGTGGTGAAGGCGGGAACGAGGCCAGGATCGGGCGGGACGGGCGG
ATCCGGCCCGTCGACAGCACGGAGAGACGAAGACTCGCCGCCGACCTGATCCGCAACGAT
CCCGGCCTTTCGCTCCGGCAGGTCGCCAAGCAGGTCGGCATCTCGCCGGAGACGGTCCGG
GACGTGCGAGGACGGCTGGAACGCGGGGAGAGCCCGACCCCGGACGGGAGCAGGAGGTTG
CGGACCAAGACACATCCGCTGAGCCTGACGGAGTCCGAACTGGGCCATGCGCTGGATCGC
GAGCGGGTCGCCGTGCTGGAGCGGCTCAAGGCCGATCCCACTCTGCGGCTGAGCGAGGTC
GGCCGGATCCTGCTGCGGATGCTCGCCATGCACTCCATCGACGGACAGGAGTGGGAGAGG
ATCCTGCGCGGGGTCCCGCCGCACCTGTACGGCGTGGTCGCCGGCTTCGCCAGGGATCAT
GCCCGGGTCTGGGCGGGTTTCGCGGATCATCTGGAGAACCGGGCGACCGATCTGGCCGCC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [14-98]  3.2e-10 PF02195
PF02195   ParBc
 [14-98]  6.00000361638163e-16 SM00470
SM00470   ParB
 [13-100]  7.00000734129903e-10 SSF110849
SSF110849   ParBc
IPR009057 Homeodomain-like (Domain)
 [100-206]  9.49999985106439e-08 SSF46689
SSF46689   Homeodomain_like
SignalP No significant hit
TMHMM No significant hit