close all open/close all

CDS information : Vanco_00060


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction5,919 / 6,758 / + [in whole cluster]
5,919 / 6,758 / + [in contig]
Location5919..6758 [in whole cluster]
5919..6758 [in contig]
TypeCDS
Length840 bp (279 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)prephenatedehydrogenase (NADP+)
Gene
Gene (GenBank)pdh
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
Q799B2
NITE
Balhi_00050
PmId
[20570618] Increased glycopeptide production after overexpression of shikimate pathway genes being part of the balhimycin biosynthetic gene cluster. (Metab Eng. , 2010)
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
ACC
R4SKG4
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [prephenatedehydrogenase (NADP+)]
MTIEKVLVVGTGLIGTSVALALREKDVAVHLSDADARAAALARDLGAGREWAGEEVDLAL
IAVPPHLVGERLAALQKRGAARAYTDVASVKVDPIADAERLGCDLTSYVPGHPLAGREKS
GPAAARADLFLGRPWALCPGTETDADALRLTGELVSLCGAKAVTVDAREHDAAVALVSHA
PHVVASAMAASLTGGDDVALGLAGQGLRDVTRIAAGDPLLWRMILAGNALPVAGVLDRIA
GDLAAAASALRSGDLDEVTDLLRRGVAGQGRIPAGSPGR
selected fasta
>putative prephenate dehydrogenase [prephenatedehydrogenase (NADP+)]
GTGACCATCGAGAAGGTGCTTGTCGTCGGGACCGGGCTGATCGGTACCTCGGTCGCGCTG
GCCCTTCGCGAAAAGGACGTGGCGGTCCACCTCTCCGACGCCGACGCGCGGGCCGCGGCG
CTCGCACGGGACCTCGGTGCCGGCCGGGAATGGGCGGGCGAAGAGGTCGACCTGGCCCTG
ATCGCCGTTCCGCCGCACCTGGTGGGGGAGCGGCTGGCCGCGCTGCAGAAGCGAGGGGCC
GCTCGGGCTTACACCGACGTGGCCAGCGTCAAGGTCGATCCGATCGCCGACGCGGAACGG
CTCGGCTGCGACCTGACCTCTTACGTGCCCGGCCATCCGCTCGCCGGCCGGGAGAAATCC
GGACCGGCGGCGGCCCGCGCCGATCTGTTCCTCGGCCGTCCCTGGGCACTGTGCCCCGGC
ACGGAGACGGACGCGGATGCCTTGCGGCTGACCGGGGAACTGGTGTCGTTGTGCGGGGCG
AAGGCCGTCACGGTGGACGCGCGCGAGCACGATGCGGCGGTGGCGCTGGTCTCGCACGCC
CCGCATGTGGTGGCGTCGGCGATGGCGGCGAGCCTGACGGGTGGTGACGACGTCGCACTG
GGCCTGGCGGGGCAGGGATTACGGGACGTGACGCGGATCGCGGCCGGGGATCCCTTGCTG
TGGCGGATGATCCTCGCGGGGAACGCCCTGCCGGTCGCGGGAGTGCTCGACCGGATCGCG
GGCGATCTCGCGGCGGCGGCCTCGGCGTTGCGGTCCGGCGACCTGGACGAGGTGACGGAT
CTGCTGCGGCGCGGCGTCGCGGGACAAGGCCGGATCCCGGCGGGTTCCCCGGGACGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003099 Prephenate dehydrogenase (Domain)
 [4-279]  PS51176
PS51176   PDH_ADH
 [18-263]  9.9e-77 PF02153
PF02153   PDH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [166-274]  1.10000150671642e-27 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [1-172]  4.40000000000001e-24 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit