close all open/close all

CDS information : Vanco_00070


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction6,956 / 8,914 / + [in whole cluster]
6,956 / 8,914 / + [in contig]
Location6956..8914 [in whole cluster]
6956..8914 [in contig]
TypeCDS
Length1,959 bp (652 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)putative ABC transporter ATP-binding protein
Gene
Gene (GenBank)abc
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SMX8
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
Q799B1
NITE
Balhi_00060
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [putative ABC transporter ATP-binding protein]
MEVVLRFEGVDKSENDPDPWVTKVRKGTVRRVLAYFRPHIGKVALFVLVAVLESLIVVAT
PLLLKELIDGGIVKNDPGVVVLMASLTAGLAVLAAALALLSGYISGKIGEGITYDLRVQA
LDHVRRLPIAFFTRTQTGVLVGRLHTELIMAQQHFTGLLMAATSLVMVVVVLAELIYLSW
LVAVISLLLIPIFLVPWIRVGRAIQRRSIRLMDANTGLGGLLQERFNVQGAMLSKLFGRP
DEEMAEYADRAGKIREVGVSLSVWGRMAFVMMGLMASLATALVYGIGGGLVLAGAFQLGT
LVAIATLLSRLFGPITQLSGMQELAQTVVVSFSRVFELLDLKPLIQERPDAVELEKDVAP
DIEFEDVVFRYPTADEVSLASLEHLRAERERGEVSPDVLRGVNFHVRAGTLTALVGPSGA
GKSTITHLVSRLYDPNSGSVRVGGHDLRDLSFASLRDTVGVVSQDAYLFHNTIRENLLYA
RPTATEDELIEACKGAQIWDLIESLPLGLDTVSGDRGYRMSGGEKQRLAIARLLLKEPTI
VVLDEATAHLDSESEAAVQRALKTALRSRTSLVIAHRLSTIREADQILVIDGGRVRERGT
HDELLAEGGLYAELYRTQFADPANDAAKPEIEEAELDEPEPQPAIQPIGFGG
selected fasta
>putative ABC transporter ATP-binding/permease protein [putative ABC transporter ATP-binding protein]
ATGGAAGTGGTGTTGCGCTTCGAGGGGGTGGACAAGAGCGAGAACGACCCCGATCCCTGG
GTGACGAAGGTCCGCAAGGGGACGGTGCGCCGGGTACTCGCCTACTTCCGCCCGCACATC
GGCAAGGTGGCGCTCTTCGTTCTCGTCGCCGTGCTGGAGTCGCTCATCGTCGTCGCAACC
CCCTTGCTGCTGAAGGAACTCATCGACGGCGGCATCGTCAAGAACGATCCCGGGGTCGTG
GTCCTGATGGCCTCCCTCACGGCCGGACTCGCCGTGCTGGCCGCGGCGCTGGCGCTGCTG
TCCGGCTACATCTCCGGAAAGATCGGCGAGGGGATCACCTACGACCTCCGGGTGCAGGCG
CTCGACCACGTCCGGCGGCTGCCGATCGCGTTCTTCACCCGCACCCAGACCGGTGTCCTG
GTCGGCAGGCTGCACACCGAACTGATCATGGCGCAGCAGCATTTCACCGGTTTGCTGATG
GCCGCCACCAGTTTGGTCATGGTCGTGGTGGTGCTGGCCGAGCTGATCTACCTTTCGTGG
CTCGTCGCCGTCATCTCGCTGCTGCTGATCCCGATCTTCCTCGTGCCGTGGATCCGGGTC
GGGCGGGCGATCCAGCGGCGCAGCATCCGGCTGATGGACGCGAACACCGGCCTCGGCGGA
CTTCTCCAGGAGCGGTTCAACGTCCAGGGCGCGATGCTCTCCAAGCTCTTCGGCCGTCCG
GACGAGGAGATGGCCGAGTACGCGGACCGCGCCGGGAAGATCCGCGAGGTCGGCGTGAGC
CTTTCCGTCTGGGGCCGGATGGCCTTCGTGATGATGGGGCTGATGGCCTCGCTCGCCACG
GCGCTCGTCTACGGGATCGGCGGCGGGCTCGTGCTCGCGGGGGCCTTCCAGCTCGGCACG
CTGGTCGCCATCGCCACGCTGCTTTCGCGGCTGTTCGGGCCGATCACCCAGCTGTCCGGG
ATGCAGGAGCTCGCGCAGACCGTCGTGGTCAGCTTCTCCCGGGTCTTCGAGCTGCTCGAC
CTGAAGCCGCTGATCCAGGAGCGTCCCGACGCGGTCGAACTCGAAAAGGACGTGGCGCCG
GACATCGAGTTCGAGGACGTGGTGTTCCGCTATCCCACCGCGGACGAGGTCTCGCTGGCG
TCGCTGGAACACCTGCGCGCCGAGCGGGAGCGCGGGGAGGTGTCGCCGGATGTCCTGCGC
GGCGTGAATTTCCACGTGCGGGCCGGAACGCTCACCGCGCTCGTCGGCCCGTCCGGCGCG
GGGAAGAGCACCATCACCCACCTGGTGTCCCGGCTGTACGACCCGAACTCCGGAAGCGTC
CGCGTCGGCGGGCACGATCTGCGGGACCTCAGCTTCGCCTCGCTCCGCGACACGGTGGGC
GTGGTCAGCCAGGACGCCTACCTCTTCCACAACACGATCCGGGAGAACCTTCTCTACGCG
CGTCCGACAGCCACCGAGGACGAGCTGATCGAGGCGTGCAAGGGGGCCCAGATCTGGGAC
CTGATCGAATCCCTCCCGCTCGGGTTGGACACCGTCTCGGGTGATCGCGGCTACCGCATG
TCGGGCGGGGAGAAGCAGCGACTGGCCATCGCCAGGCTGCTGCTGAAGGAGCCGACGATC
GTCGTGCTCGACGAAGCCACCGCGCATCTGGACTCCGAATCGGAGGCCGCCGTCCAGCGG
GCGCTCAAGACCGCGCTGCGCAGCCGTACCTCGCTGGTGATCGCCCACCGGTTGTCCACG
ATCCGCGAGGCCGACCAGATCCTCGTGATCGACGGCGGCCGGGTGCGGGAGCGCGGGACG
CACGACGAGCTGCTGGCCGAAGGTGGCCTTTACGCCGAGCTCTACCGCACGCAGTTCGCC
GACCCGGCGAACGACGCGGCCAAGCCGGAAATCGAAGAAGCCGAGCTGGACGAGCCTGAG
CCTCAGCCGGCGATCCAACCCATTGGCTTCGGAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [45-314]  8.19999999999997e-19 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [362-617]  PS50893
PS50893   ABC_TRANSPORTER_2
 [423-548]  9.9e-24 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [408-594]  4.49999046578037e-17 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [16-343]  2.19999900980707e-62 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [520-534]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-327]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [41-63]  Transmembrane (i-o) [78-100]  Transmembrane (o-i) [155-172]  Transmembrane (i-o) [176-198]  Transmembrane (o-i) [274-296]  Transmembrane (i-o)
Transmembrane 5