close all open/close all

CDS information : Vanco_00080


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction8,917 / 18,357 / + [in whole cluster]
8,917 / 18,357 / + [in contig]
Location8917..18357 [in whole cluster]
8917..18357 [in contig]
TypeCDS
Length9,441 bp (3,146 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase A
Gene
Gene (GenBank)vpsA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SV84
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
O52819
NITE
Chlor_00030
PmId
[10716695] Heterologous expression in Escherichia coli of the first module of the nonribosomal peptide synthetase for chloroeremomycin, a vancomycin-type glycopeptide antibiotic. (Proc Natl Acad Sci U S A. , 2000)

close this sectionPKS/NRPS Module

A1 leucine
2 beta-hydroxytyrosine(Bht)
3 asparagine
A36..427
PCP503..569
C600..892
A1058..1448
PCP1523..1589
E1623..2075
C2088..2379
A2560..2962
PCP3044..3110

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase A]
MNSAARTPATVLELFASRVGRTPGAVAVVDGDRVLTYRELDEAAGLLAGRLAGRGIRRGD
RVAVMMGRSADLLVALLAVWKAGATYVPVDAAYPAPRVEFMVRDSAAALMVCSVASRDAV
PEGVDSLVVDAVTDEDGRAPTATVRPEDLAFVMYTSGSTGRPKGVAITQGSVADLVRDPG
WAMGPDDAVLMHSPHAFDASLFEVWTPLASGARVVIAEPGSVDVRRLRAAAAAGVTRVYL
TAGSFRAVAEEAPESFAAFREVLTGGDVVPAHAVQRVRQACPEARFRNMYGPTEATMCAT
WYPLEPGEVLGAVVPIGRPLAGRRVQVLDESLRPVEPGVVGDLYLSGCLAEGYFGRPGLT
AERFVADPSAPGQRMYWTGDLAQWTADGELLFAGRADDQVKVRGFRIEPGEIEAALIAQP
EVHDAVVAAIEGRLIGYVVADEDVDPVVVRERLRAELPEYLVPVVVLTLDALPLTRNGKV
DRAALPAPEFATGAAGREPATEEERVLCGLFADVLRLDRAGVDDGFFDLGGDSIFAMRLA
ARAAKAGLLVTPVQIFEEKTPARLAAVARPVPADEPLDGPLLDLTEAEEAELAIAAPGAE
EIWPLAPLQEGLLFESILDDEGSDIYQVQVILELNGPLDEARLRAAWDTVVHRHPELRLT
FHRLESGKTVQAVHGDVAVPWRAVDLAGADDVDAAVGALAGQEQGKRFDLAKAPLVRLVL
IRIGEDRHRLLFVIHHILVDGWSVAVILNEVADAYTAGGRLPEQRGGASFKDYLAWLDRQ
DKDAARAAWRDELAGLDEPALIATTSVETDYDYRATHLTPALHTRLLEFAREHGLTPSTV
VHAAWALVLARLTRRTDVVFGTMVATRPAELEGIESMPGLLMSAVPVRVPLDGGQPVVDL
LTDLHTRQTALKPHQHLGLPEIQKAAGPGAGFDTLLVIENYPREYAAQFTHLRTIEGTHY
PLTLGITPGERFKIQLGYWQGQVPDAVAESLLEWFVGAIGALVADPARPVGRIGVGTAET
REWAAPLVAGEPLPSLVGRIAARLPDNVALVDSEGELSYAELWERSLKLAAVLRDNGVGS
ESRVGLVVGRSSWWTVGMLGVLLAGGTFVPVDPAYPDERKEWIFRSADPMLVVCEGTTRG
AVPVEFADRLLVVDDVDLSATPEAELPRVDPRSAAYVIYTSGSTGTPKGVVVTHTGLGNL
ALAHIDRFRVTPSSRVLQFAALGFDTIVSEVMMALLSGATLVVPPEQELPPRMAFSETLE
RWGITQVKAPPSVLGTVDALPPTVETVVAAGELCPPGLVDRLSADRRMINAYGPTETTIC
ATMSLPLTPGQHPIPFGGPVPGVRGYLLDSFLRPLPPGVTGELYLSGIGVARGYLGRPGL
TAERFVADPFAPGERMYRTGDLAYWTDQGELVSAGRADDQVKIRGFRVEPREIEFALSAY
PRITQATVTVREDRLLAYVTPGDIDTQAVRKHLASRMPQYMVPAAVVALDTLPLTAHGKI
DRRALPDPEFTTGAPAREPATETERVLCELFAGVLGLEQVGVDDSFFDLGGDSILSMQLA
ARARRSGLTFSAADVFDGKTPERIARLAEESAPPEPGRPAKSDGVGEVPWTPVTRMLGDG
VTGSAFAQWMVVGAPADLTEKTVAAGFAAVVDAHDMLRARVVDDESGRRLLVGERGSVTG
SVTRVGLDGRPVDEVVEEAARDAVSKLDPSAGVLARAVWVDAGPDRIGRLVVVVHHLSVD
GVSWRVLLSDLQSACEAVAAGREPVLEPVEVSFKQWAGLLGEWAVSAERVGELAAWKAIL
GQEQPAATRELTTSQAAKGEVRSRSWVVPKTETSALVGRAPVVFHCGVHEILLAGLAGAV
TRWRGGDTVLVDVESHGRHPADGMDLSRTVGWFTSAHPVRLEVAGTELADVLAGGPAAGR
LLKTVKEQSRAVPGDGLGYGLLRYLNDTTAPVLAELPSARIGFNYMGRFATGEDSGVRAW
QPVGDIGSSLEPGMGLPHAIEVNAIVQDLPDGPELTLMLEWQEDLLGEAEIDQLGQGMLA
VLAGLARQAEDPAAGGHTASDFALVALGQDEIEALEAEFADAGGVADLLPLSPLQHGLAF
HAGFSGDGVDVYTAQAVLELTGPLDMPLLRKSVRALLDRHANLRAGFRHAADGSAYQVIP
GALAVPVTLVDVTGSADPEAEAAAVAAAERARPFDLAKPPLLRLTVVALGENDHRLVLTN
HHILLDGWSTPLLLDELLTLYRDGAVPSALAPVNPYREYLAWVRETDRDAAITAWRDALA
GLPEPTLVAADRAVPVQVPGQMWAELDEAFAGALAARARECGVTVSTMLQAVWGMVLAAI
TGRDDVVFGAVVSGRPAELPGIETMVGLFINTVPVRVRMEPRHTFAELVKEVQDEQIALL
AHHHVGLTDIQQTAGLGRLFDTLVVYENYPRPAETADAEPDRLRVLGMTAADATHYPLAL
AVVPGESLRLRLEHQPAMFTTEQAAAVLDRFTRVLEAVVADPGTPLAAVPILSESEQREL
RARNDTAVPVPDRTLPELFAAQVAATPDATAVTFEDRSLSYAELDARADRLARRLIERGV
GPEGLVAVMMPRSLDLVVTVLAITKTGGAWLPIDPVYPADRVTYILDDARPALVITSAAL
ADSPAGEVLAARPATVVLDDLATAGGEHTPVTDADRIRPLDPRHPAYLIYTSGSTGRPKA
VVVTHRNLANYLFHCGKKYPGLRGRSLLHSSIAFDLTVTAMLTPLTVGGTVQVGALEDLI
GTVESAPALFLKATPSHLQTLETGSREIAVPGDLLLGGEQLSVETVADWRRTYPNTVVVN
EYGPTEATVGCVEYRLEPGQAAPSGDVVPIGTPMTNMRAFVLDSWLRPVPPGAVGELYVS
GAGVARGYLGRAGLTATRFVADPFGAGELMYRTGDLVRWNPDGELVFAGRVDDQVKVRGY
RIEPGEIEAALEAHESVGQAVVLARDSASGKRLIGYVTPAGDTGVDVAAVRAAVAARLPE
YMVPAAVVVLDALPLTANGKVDRDALPDPDFNERVSGREPVTEAERLLCALFAEVLGLER
AGADDSFFELGGDSILSMRLAARAHREGMAFGAREVFELRTPAGIAAIVERAPDVPAAAD
YAGSDVALLELNQDEIDEFEAEFDAS
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase A]
ATGAATTCCGCAGCGCGGACCCCCGCGACGGTGCTGGAGCTGTTCGCCTCGCGGGTGGGG
CGGACGCCCGGCGCGGTGGCCGTGGTCGACGGCGACCGGGTGCTGACCTACCGGGAACTC
GACGAGGCCGCGGGCCTGCTGGCCGGACGGCTGGCGGGCCGGGGCATCCGCCGTGGCGAC
CGGGTCGCGGTGATGATGGGCCGCTCGGCGGATCTGCTGGTGGCGCTGCTCGCCGTGTGG
AAGGCGGGGGCGACGTACGTACCGGTGGACGCCGCCTATCCGGCGCCGCGGGTGGAATTC
ATGGTGCGCGATTCGGCGGCCGCGCTGATGGTGTGCTCGGTCGCGTCGCGTGACGCCGTA
CCGGAGGGCGTCGATTCGCTCGTGGTGGACGCCGTCACGGACGAGGACGGGCGTGCGCCG
ACGGCCACGGTGCGCCCGGAGGACCTGGCGTTCGTGATGTACACGTCCGGCTCCACGGGC
AGGCCCAAGGGGGTGGCGATCACCCAGGGCAGTGTCGCGGACTTGGTGCGGGACCCCGGT
TGGGCGATGGGGCCGGACGACGCCGTGCTGATGCATTCACCGCACGCCTTCGACGCGTCC
CTGTTCGAGGTCTGGACGCCGCTGGCCTCGGGCGCGCGGGTGGTGATCGCCGAACCGGGT
TCGGTGGACGTGCGGCGCCTGCGCGCCGCGGCCGCGGCCGGGGTGACGCGGGTGTACCTG
ACCGCGGGGAGTTTCCGCGCGGTGGCGGAGGAGGCGCCGGAGTCGTTCGCGGCGTTCCGT
GAGGTGCTGACCGGCGGTGACGTGGTGCCCGCGCACGCGGTGCAGCGGGTGCGGCAGGCC
TGTCCCGAGGCGCGGTTCCGGAACATGTACGGGCCGACGGAAGCGACGATGTGCGCGACG
TGGTACCCGCTGGAACCGGGCGAGGTGCTGGGTGCGGTGGTGCCGATCGGACGTCCGCTG
GCCGGCCGCCGGGTCCAGGTGCTCGACGAGTCGCTGCGCCCGGTGGAGCCGGGCGTGGTC
GGCGACCTGTACCTCTCCGGATGTCTGGCGGAGGGCTACTTCGGCCGGCCGGGGCTGACG
GCGGAGCGGTTCGTCGCGGATCCCTCCGCGCCGGGACAGCGGATGTACTGGACGGGTGAC
CTCGCCCAGTGGACGGCGGACGGTGAGCTGCTGTTCGCGGGCCGGGCCGACGACCAGGTG
AAGGTCCGCGGGTTCCGGATCGAGCCCGGCGAGATCGAGGCCGCGCTGATCGCCCAGCCG
GAGGTCCACGACGCCGTGGTCGCGGCGATCGAGGGACGGCTGATCGGCTACGTGGTGGCC
GATGAGGACGTGGATCCCGTCGTCGTCCGCGAGCGCCTCCGCGCGGAATTGCCGGAATAC
CTGGTTCCCGTCGTCGTCCTCACGCTGGACGCGTTGCCCTTGACCCGTAACGGAAAGGTG
GACAGGGCGGCGCTGCCCGCGCCCGAGTTCGCGACGGGCGCCGCGGGCCGTGAACCCGCC
ACCGAGGAGGAACGCGTCCTTTGTGGACTGTTCGCCGACGTGCTCCGGCTCGACCGGGCC
GGGGTCGACGACGGCTTCTTCGACCTGGGCGGGGATTCGATCTTCGCGATGCGCCTGGCG
GCACGCGCGGCCAAGGCGGGCCTGCTGGTGACACCCGTCCAGATCTTCGAGGAGAAGACC
CCCGCGCGGCTGGCGGCGGTGGCGCGTCCGGTACCGGCCGACGAGCCCCTCGACGGCCCC
CTGCTCGATTTGACCGAAGCGGAGGAGGCGGAGCTGGCGATCGCCGCTCCGGGTGCCGAG
GAGATCTGGCCGCTGGCGCCGTTGCAGGAGGGGTTGCTCTTCGAGTCGATCCTGGACGAC
GAGGGCTCCGACATCTACCAGGTGCAGGTGATCCTGGAGCTGAACGGGCCGCTGGACGAA
GCCCGGCTGCGGGCCGCGTGGGACACGGTCGTCCACCGGCACCCCGAGCTTCGGCTCACC
TTCCACCGGCTCGAGTCGGGCAAGACGGTGCAGGCCGTCCACGGGGACGTCGCCGTGCCG
TGGCGGGCGGTGGATCTGGCGGGTGCCGACGACGTCGACGCGGCCGTCGGGGCCTTGGCC
GGACAGGAACAGGGAAAGCGGTTCGATCTCGCCAAGGCGCCGCTGGTCCGGCTGGTGCTG
ATCCGGATCGGCGAGGACCGGCACCGGCTGCTGTTCGTCATCCACCACATCCTGGTCGAC
GGCTGGTCGGTGGCGGTGATCCTCAACGAGGTCGCCGACGCGTACACGGCGGGCGGACGG
CTGCCGGAACAGCGCGGCGGCGCCTCCTTCAAGGACTACCTGGCGTGGCTGGACCGGCAG
GACAAGGACGCGGCGAGGGCGGCCTGGCGCGACGAGCTGGCCGGTCTCGACGAGCCCGCG
CTGATCGCGACGACGTCCGTCGAGACGGACTACGACTACCGCGCCACCCACCTGACCCCG
GCGCTGCACACCAGGCTGCTGGAGTTCGCCCGTGAGCACGGGCTGACGCCGAGCACGGTG
GTGCACGCCGCCTGGGCGCTGGTGCTGGCGCGTCTCACGCGGCGGACCGACGTGGTGTTC
GGCACCATGGTCGCGACCCGCCCCGCGGAACTCGAGGGTATCGAGTCGATGCCGGGCCTG
CTGATGAGCGCGGTGCCGGTGCGGGTGCCCCTCGACGGCGGCCAACCGGTCGTGGACCTG
CTGACCGACCTGCACACCAGGCAGACGGCCCTCAAACCGCATCAGCATCTGGGCCTGCCG
GAGATCCAGAAGGCGGCCGGACCCGGCGCGGGCTTCGACACGCTGCTGGTGATCGAGAAC
TACCCGCGGGAGTACGCCGCTCAGTTCACGCATCTGCGCACCATCGAAGGCACGCACTAT
CCGCTGACCCTCGGCATCACGCCCGGGGAGCGGTTCAAGATCCAGCTCGGCTACTGGCAG
GGACAGGTTCCCGACGCCGTCGCCGAATCGCTGCTGGAGTGGTTCGTCGGCGCGATCGGC
GCGCTGGTCGCCGATCCCGCCCGCCCGGTGGGGCGGATCGGGGTGGGCACGGCCGAGACG
CGCGAGTGGGCCGCGCCGTTGGTGGCGGGCGAGCCGCTGCCGTCGCTGGTCGGACGGATC
GCGGCGCGGCTGCCGGACAACGTGGCGCTGGTGGACAGCGAGGGTGAGCTGTCCTACGCG
GAGTTGTGGGAGCGGTCGCTGAAGCTCGCGGCCGTGTTGCGGGACAACGGTGTCGGGTCC
GAAAGCCGGGTCGGCCTGGTGGTGGGGCGCTCGTCCTGGTGGACGGTCGGCATGCTGGGC
GTGTTGCTGGCGGGCGGCACTTTCGTGCCGGTGGACCCGGCCTATCCGGACGAGCGCAAG
GAATGGATCTTCCGGAGCGCGGATCCGATGCTGGTGGTGTGCGAGGGGACGACGCGGGGA
GCGGTGCCCGTCGAGTTCGCGGACCGGCTGCTGGTGGTCGACGACGTCGACCTGTCGGCG
ACTCCGGAAGCGGAGCTGCCGCGAGTGGATCCGCGCAGCGCCGCGTACGTGATCTACACG
TCGGGGTCGACGGGAACTCCGAAGGGAGTCGTCGTCACCCATACCGGCCTGGGAAACCTG
GCGCTGGCGCATATCGACCGGTTCCGGGTGACGCCGTCGTCGCGGGTGCTGCAGTTCGCC
GCGCTCGGCTTCGACACCATCGTGTCCGAGGTGATGATGGCGTTGCTGTCGGGCGCGACG
CTGGTGGTGCCGCCGGAGCAGGAACTGCCGCCCCGGATGGCGTTCTCCGAAACGCTGGAA
CGGTGGGGCATCACGCAGGTGAAGGCGCCGCCGTCGGTGCTGGGCACGGTCGACGCGCTG
CCGCCGACCGTGGAAACGGTGGTGGCGGCGGGCGAACTCTGCCCGCCGGGTCTGGTGGAC
CGGCTGTCCGCGGACCGGCGGATGATCAACGCCTACGGGCCGACCGAGACCACGATCTGC
GCGACGATGAGCCTGCCGCTGACGCCGGGTCAGCATCCGATCCCGTTCGGTGGCCCGGTT
CCCGGGGTGCGCGGATATCTGCTGGACTCGTTCCTGCGTCCGCTGCCTCCCGGGGTGACC
GGTGAGCTGTACCTTTCCGGGATCGGGGTGGCCCGCGGCTATCTGGGCCGTCCGGGGCTG
ACGGCGGAGCGGTTCGTCGCCGATCCGTTCGCCCCCGGTGAGCGGATGTACCGGACCGGG
GACCTGGCCTACTGGACCGACCAGGGTGAGCTGGTGTCCGCCGGGCGCGCCGACGACCAG
GTCAAGATCCGCGGGTTCCGGGTCGAACCCCGCGAGATCGAGTTCGCCTTGTCCGCCTAC
CCCCGGATCACGCAGGCCACGGTGACCGTCCGCGAAGACCGCCTGCTCGCCTACGTGACA
CCGGGCGACATCGACACGCAGGCGGTGCGGAAACATCTCGCGTCCCGGATGCCCCAGTAC
ATGGTGCCCGCGGCGGTGGTGGCGCTGGACACCCTGCCGCTGACGGCGCACGGGAAGATC
GACCGGCGCGCGCTACCCGATCCCGAGTTCACCACCGGGGCGCCCGCCAGGGAACCGGCC
ACCGAGACCGAGCGGGTGCTGTGCGAGTTGTTCGCCGGTGTCCTCGGTCTGGAGCAGGTC
GGGGTGGACGACAGTTTCTTCGATCTGGGCGGGGACTCCATCCTTTCGATGCAGCTGGCG
GCGCGGGCACGGCGTTCGGGGCTGACGTTCTCCGCCGCCGACGTCTTCGACGGGAAGACA
CCGGAGCGGATCGCGCGGCTGGCGGAGGAATCGGCGCCGCCGGAGCCGGGGCGTCCGGCG
AAATCCGACGGTGTGGGCGAGGTCCCGTGGACGCCGGTGACGCGGATGCTGGGCGACGGC
GTCACGGGATCGGCGTTCGCGCAGTGGATGGTGGTGGGCGCGCCCGCGGATCTGACGGAG
AAGACGGTGGCGGCCGGGTTCGCGGCCGTGGTGGACGCGCACGACATGCTGCGGGCACGG
GTCGTCGACGACGAGAGCGGCCGTCGCCTGCTGGTCGGCGAGCGTGGTTCGGTCACCGGG
TCGGTCACCCGCGTGGGACTCGACGGCCGTCCGGTGGACGAGGTCGTCGAGGAGGCGGCG
CGCGACGCCGTGAGCAAGCTGGATCCGTCGGCTGGCGTGCTGGCGCGGGCGGTGTGGGTG
GACGCCGGACCGGACCGGATCGGGCGGCTCGTGGTGGTGGTGCACCACCTGTCGGTCGAC
GGTGTGTCGTGGCGGGTGCTGCTTTCGGATCTGCAAAGCGCTTGCGAGGCGGTGGCCGCG
GGCCGGGAGCCGGTGCTGGAGCCGGTGGAGGTGTCCTTCAAGCAGTGGGCGGGCCTGCTC
GGTGAGTGGGCGGTCTCCGCGGAGCGCGTCGGGGAATTGGCGGCGTGGAAGGCGATCCTC
GGACAGGAGCAGCCGGCCGCCACCCGTGAGCTGACCACGAGTCAGGCCGCGAAGGGCGAA
GTGCGCTCGCGGTCGTGGGTGGTGCCGAAGACGGAGACGTCGGCGTTGGTCGGGCGGGCA
CCGGTCGTGTTCCACTGCGGCGTCCACGAGATCCTGCTCGCCGGGCTGGCCGGAGCGGTG
ACGCGGTGGCGTGGCGGGGACACGGTCCTGGTGGACGTGGAAAGCCACGGCCGCCATCCG
GCCGACGGGATGGATCTGTCCCGGACGGTGGGCTGGTTCACCAGCGCGCATCCGGTCCGG
CTGGAAGTGGCGGGGACCGAGCTGGCCGACGTGCTCGCCGGTGGTCCGGCGGCCGGGCGT
CTGCTGAAGACGGTCAAGGAGCAGTCGCGGGCCGTGCCCGGCGACGGGCTCGGCTACGGA
CTGCTGCGCTACCTCAATGACACGACCGCGCCGGTACTGGCGGAACTGCCGTCGGCGCGG
ATCGGGTTCAACTACATGGGCAGGTTCGCCACCGGTGAGGACAGCGGGGTGCGGGCGTGG
CAGCCGGTCGGGGACATCGGCAGCTCGCTCGAACCCGGAATGGGCCTGCCGCACGCGATC
GAGGTCAACGCGATCGTCCAGGACCTGCCGGACGGGCCCGAACTGACGCTCATGCTGGAA
TGGCAGGAGGATTTGCTCGGCGAAGCCGAGATCGACCAACTGGGCCAAGGGATGCTGGCC
GTGCTGGCCGGGCTCGCCCGGCAGGCGGAGGATCCCGCCGCGGGCGGGCACACCGCGTCC
GACTTCGCTCTCGTCGCACTGGGCCAGGACGAGATCGAGGCCCTCGAAGCCGAATTCGCG
GACGCCGGTGGGGTGGCCGACCTGCTGCCGCTGTCACCGTTGCAGCACGGTCTCGCCTTC
CACGCCGGTTTCTCCGGTGACGGCGTCGATGTCTATACCGCGCAAGCGGTGCTGGAACTG
ACCGGTCCGCTGGACATGCCGCTGCTGCGGAAGTCCGTCCGCGCGCTCCTGGACAGGCAC
GCGAATCTGCGCGCCGGCTTCCGGCACGCCGCCGACGGGTCCGCGTACCAGGTGATCCCC
GGTGCCCTGGCGGTGCCGGTGACCCTGGTGGACGTGACCGGGTCGGCGGATCCGGAGGCC
GAGGCGGCGGCGGTGGCCGCGGCCGAGCGGGCCCGGCCGTTCGATCTGGCCAAGCCCCCG
CTGCTGCGGCTGACGGTGGTGGCCTTGGGCGAGAACGACCACCGGCTGGTGCTGACCAAC
CACCACATCCTGCTCGACGGCTGGTCGACGCCGCTGCTGCTGGACGAACTGCTCACGCTG
TACCGCGACGGGGCGGTTCCGTCCGCGCTCGCGCCGGTCAACCCGTACCGGGAGTACCTG
GCCTGGGTGCGCGAAACCGATCGGGACGCGGCGATCACCGCCTGGCGCGACGCCTTGGCG
GGACTGCCGGAGCCGACGCTGGTCGCGGCCGACCGGGCGGTCCCGGTCCAGGTGCCCGGG
CAGATGTGGGCCGAACTGGACGAGGCGTTCGCCGGTGCGCTGGCCGCGCGGGCCCGCGAG
TGCGGGGTCACCGTCAGCACGATGCTGCAGGCGGTGTGGGGCATGGTGCTGGCCGCGATC
ACCGGACGCGACGACGTCGTGTTCGGGGCGGTGGTGTCCGGCCGCCCGGCGGAACTGCCC
GGCATCGAGACCATGGTCGGGCTGTTCATCAACACCGTCCCGGTCCGGGTCCGGATGGAA
CCCCGGCACACCTTCGCCGAACTGGTGAAGGAAGTGCAGGACGAGCAGATCGCCTTGCTG
GCCCATCACCACGTCGGCCTCACCGACATCCAGCAGACCGCCGGACTGGGCAGGCTGTTC
GACACGCTCGTCGTCTACGAGAACTACCCCCGGCCAGCCGAGACCGCCGACGCGGAACCG
GATCGGTTGCGGGTGCTGGGAATGACCGCCGCCGACGCCACGCACTATCCGCTGGCGCTG
GCCGTCGTCCCGGGCGAAAGCCTGCGGCTGCGGCTGGAACACCAGCCCGCGATGTTCACC
ACCGAGCAGGCGGCCGCCGTGCTGGACCGGTTCACGCGGGTGCTCGAAGCCGTGGTCGCC
GATCCGGGGACGCCGCTCGCGGCGGTGCCGATCCTGTCCGAGTCCGAACAGCGAGAGCTG
CGGGCGCGCAACGACACCGCGGTGCCGGTGCCGGACCGGACGCTGCCGGAGTTGTTCGCC
GCGCAGGTCGCCGCCACCCCGGACGCGACCGCGGTGACCTTCGAGGACCGGTCGCTGTCC
TACGCCGAACTCGACGCCCGCGCCGATCGGCTGGCACGCCGGCTCATCGAGCGGGGTGTC
GGTCCCGAAGGCCTGGTCGCGGTGATGATGCCCCGGTCGCTGGACCTGGTCGTCACGGTG
CTGGCGATCACCAAGACCGGAGGAGCCTGGCTGCCGATCGACCCGGTCTACCCGGCCGAT
CGTGTCACCTACATCCTCGACGACGCCCGGCCGGCACTGGTGATCACGAGCGCCGCGCTG
GCGGACTCGCCCGCCGGTGAGGTGCTGGCGGCACGGCCGGCGACGGTGGTGCTCGACGAT
CTCGCGACCGCGGGCGGCGAGCACACGCCGGTCACCGACGCCGATCGGATCCGGCCGCTG
GATCCGCGTCATCCGGCCTACCTCATCTACACCTCGGGCTCGACCGGCCGCCCCAAGGCC
GTCGTCGTCACCCACCGGAACCTGGCGAACTATCTGTTCCACTGCGGGAAGAAGTACCCG
GGGCTGCGGGGACGGTCGCTGCTGCATTCGTCGATCGCCTTCGACCTGACGGTCACCGCG
ATGCTCACCCCGCTCACCGTCGGGGGAACGGTCCAGGTCGGTGCGCTGGAAGACCTGATC
GGCACGGTGGAAAGCGCCCCGGCGCTGTTCCTCAAGGCCACGCCGAGCCATTTGCAGACG
CTGGAGACCGGCTCCCGGGAGATCGCCGTTCCCGGTGATCTCCTGCTCGGCGGCGAACAG
TTGTCCGTCGAGACGGTCGCCGACTGGCGCCGGACGTATCCGAACACCGTGGTGGTCAAC
GAATACGGGCCGACGGAGGCGACGGTCGGGTGCGTCGAATACCGGCTCGAACCCGGGCAG
GCGGCGCCGTCCGGCGACGTGGTGCCGATCGGCACCCCGATGACGAACATGCGGGCGTTC
GTCCTGGATTCGTGGCTGCGGCCGGTGCCGCCGGGCGCGGTGGGCGAGTTGTACGTGTCC
GGTGCGGGCGTGGCACGGGGTTATCTGGGGCGGGCGGGGCTGACCGCGACGCGGTTCGTG
GCCGATCCGTTCGGTGCCGGTGAACTGATGTACCGGACCGGGGACCTGGTGCGGTGGAAC
CCGGACGGGGAACTGGTCTTCGCCGGCCGTGTCGACGACCAGGTGAAGGTGCGGGGATAC
CGCATCGAACCCGGTGAGATCGAGGCGGCACTGGAGGCGCACGAATCGGTGGGGCAGGCC
GTCGTACTGGCCAGGGACAGTGCTTCCGGCAAACGACTGATCGGCTATGTGACTCCCGCC
GGGGACACCGGGGTGGACGTCGCCGCGGTGCGCGCGGCCGTGGCGGCCCGGCTGCCGGAG
TACATGGTGCCCGCGGCGGTGGTGGTGCTCGACGCGCTTCCGTTGACGGCCAACGGGAAA
GTGGACCGGGACGCGCTGCCGGATCCCGACTTCAACGAACGCGTCTCGGGCCGGGAACCC
GTCACGGAGGCCGAACGGCTGCTGTGCGCGCTTTTCGCCGAGGTCCTCGGCCTGGAGCGG
GCAGGCGCGGACGACAGTTTCTTCGAACTGGGCGGGGATTCGATCCTGTCGATGCGACTG
GCGGCGCGGGCGCACCGCGAGGGAATGGCCTTCGGCGCACGCGAGGTGTTCGAGCTGCGG
ACGCCCGCCGGGATCGCGGCGATCGTCGAGCGGGCACCGGATGTGCCCGCCGCGGCGGAC
TATGCCGGGTCCGACGTCGCCCTGCTCGAACTGAACCAGGACGAAATCGACGAATTCGAA
GCCGAGTTCGACGCCTCGTGA
[1] A36..427
[1] leucine198..298
[1] PCP503..569
[2] C600..892
[2] A1058..1448
[2] beta-hydroxytyrosine(Bht)1225..1320
[2] PCP1523..1589
[2] E1623..2075
[3] C2088..2379
[3] A2560..2962
[3] asparagine2735..2830
[3] PCP3044..3110
[1] A106..1281
[1] leucine592..894
[1] PCP1507..1707
[2] C1798..2676
[2] A3172..4344
[2] beta-hydroxytyrosine(Bht)3673..3960
[2] PCP4567..4767
[2] E4867..6225
[3] C6262..7137
[3] A7678..8886
[3] asparagine8203..8490
[3] PCP9130..9330

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-427]  4.49999999999996e-107 PF00501 [1058-1448]  7.99999999999993e-107 PF00501 [2560-2962]  2.20000000000002e-109 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [600-892]  5.89999999999994e-63 PF00668 [1623-1903]  1.8e-32 PF00668 [2088-2379]  6.29999999999997e-67 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1548-1563]  PS00012 [3069-3084]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [494-569]  3.30000000000002e-70 G3DSA:1.10.1200.10 [1513-1591]  3.30000000000002e-70 G3DSA:1.10.1200.10 [3036-3112]  3.30000000000002e-70 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [496-570]  1.39999892049878e-15 SSF47336 [1516-1590]  2.39999798157265e-18 SSF47336 [3037-3111]  3.30000526807186e-18 SSF47336
SSF47336   ACP_like
 [503-569]  PS50075 [1523-1589]  PS50075 [3044-3110]  PS50075
PS50075   ACP_DOMAIN
 [506-566]  2.2e-08 PF00550 [1526-1587]  1.9e-11 PF00550 [3047-3107]  6.80000000000001e-11 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1918-2075]  8.00000000000001e-35 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [36-427]  9.49999999999983e-123 TIGR01733 [1058-1448]  3.39999999999996e-119 TIGR01733 [2560-2962]  1e-125 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [504-572]  1.10000029896148e-05 SM00823 [1524-1592]  5.20000089003336e-10 SM00823 [3045-3113]  4.39999967439747e-06 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [152-163]  PS00455 [1177-1188]  PS00455 [2688-2699]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit