close all open/close all

CDS information : Vanco_00090


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction19,050 / 31,226 / + [in whole cluster]
19,050 / 31,226 / + [in contig]
Location19050..31226 [in whole cluster]
19050..31226 [in contig]
TypeCDS
Length12,177 bp (4,058 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase B
Gene
Gene (GenBank)vpsB
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4SZ73
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
Q939Z0
NITE
Balhi_00080
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 beta-hydroxytyrosine(Bht)
C7..301
A482..879
PCP957..1023
E1060..1488
C1497..1788
A1969..2363
PCP2446..2512
E2549..2994
C3006..3297
A3481..3870
PCP3955..4021

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase B]
MNQSRIEEIWPLSPLQAGLLFHAVYDGEGPDVYIGHWILDLTGPVDAPRLRAAWETLLAR
HAPLRACFRQRKSGETVQIIARQVDLPWREIDLSHLDDPEKAVRELAEEDRTTRFDLAQA
PLLRLTFLRLGDDTYRLVVTCHHTIMDGWSLPIVLDEMSKLYAADGESPGLPEVTSYRDY
LAWLGRQDKEKSLAAWAERLRGVDEPTLVVPADPGRAPAEPESVEVGLPENLTRSLGELA
RAHGLTLNTVVQGAWALVLAQLAGRTDVVFGAAVSARPPDLPGVEGMVGLFLNTVPVRVR
LSGATPVVELLTEVQRRQSALIPDQYVGLADIQQAVGPGAVFDTLIVFEKFHHDSGELGS
ADTFGIQVHQGRVAAHYPLTLVAVPGESMYFKLDYLTEFFDRDAALAIAERFTGVLRQLT
RAGDLTVADVEVASAAERALVVDAWGVTSQAAPGVPALDLFDSQVKRRSDEVAVVDGDRT
LTYGELAGQAERLAGYLHDRGVRRGDRVAVVLDRSPELIATLLAVWKAGAAYVPVDPAYP
VDRVQFMLADSAPAAVVCAERYRDAVLDTGLAPVILDDPRTRREVADSARLSAVTSADDL
AYVMYTSGSTGTPKGVAVSHANVAALAGEPGWRVGPGDAVLLHASHAFDISLFELWVPLL
SGARVVLAGSGAVDGAALAAHVAAGVTAAHLTAGAFRVLADESPESVAGLREVLTGGDAV
PLAAVERVRRVCPDVRVRHLYGPTEATLCATWWLLEPGDETGAVLPIGRPLAGRRVYVLD
AFLRPVPAGVAGELYVAGAGVARGYLGRPVLTAERFVADPFVPAGRMYRTGDLAYWTDQG
TLAFAGRADDQVKIRGYRVEPGEIEAVLAGLPGVGQAVVLAKGEHLIGYVVAEAGQDADP
ARLRELLAETLPEFMVPAVVLVLDELPLTVNGKVDRRALPEPDFASKSASREPVTEAERV
LCGVFADVLGLDRVGVGDSFFELGGDSISSMQVAARARREGISLTPRQVFEHRTPERLAA
LAQEAVTAPRAEAVTGVGEIPRTPVMRALGEDALRPGFAQARVVVTPAGMNPEALVGALQ
AVLDTHDLLRARVEPDGRLIVPERGAMDAAGLVTRVAGTGDLDEIAEREVRTATGTLNPA
AGIMARVVWVDAGDAERGRLAFVAHHLAVDAVSWGILLPDLRAAYDAVVSGGTPALEAPV
TSYRQWALRQTEQALSERTVAELDQWVALLDGADPAPAGDSGQAHSWSTRLSGTEVRTLV
AQLPGAFHCGIQDVLLAGLAAAVARVRGTGAGLLVDVEGHGREAADGEDLLRTVGWFTSV
HPVRFDLSDVDLAAAGRLLKTVKEQIRAVPGDGSGYGLLRHLNPDTGAKLAKSPSARIGF
NYLGRTVLAPRATAWEPVGEGPLGAGPDMVLAHAVEVSAEVQDTPAGPRLGLAIDARDAD
PATVERLGEAWLETLTALAALAGDPAAGGHTPSDFDLVGLTQQDVTELEAAAPGLTDIWP
LSPLQEGMLFERDFDADGVDVYQSQRILDLDGPLDAERLRAAWDRVLARHASLRTGFHQL
GSGETVQVVAGDVELPWRTVDLSSLDEAAAAAEVERLLAEDQSRRFDVTAPPLLRLSLIR
LGADRHRLVLTSHHLVLDGWSTPLVVGEVSIAYAGEEIPSSAPSYKDYLAWLGEQDEDAA
RAAWRAELAGADEPSLVDAEADKTLVMPGDHAEWVAEETTRALAELARGNGLTTSTILQA
AWALVLARLAGRTDVVFGSVVSGRPAEVPDVERMVGMFINTVPVRVRLDGARPVLELFQD
LQARQAALTEHQYLGLPEIQKAAGTGAVFDTIVMIENYPHTADGLGDDGGVAISSVTTRT
GTGYPLTMNVSLGDRLRINVAYRPDRIDGATAAEVARQLVRVLDQVVARPSLPVGRLGVT
SEAARASVVERWNATGKAASETSVLELFRRQAGASPDAVAVTDGERTLSYAGLDRESDRL
AGQLADAGVRRGDRVGVVMDRGADLIVALLAVWKAGAAQVPVNVDYPGERIERMLADAGA
SVAVCLEASRKAVPDGVSPVVADVPAIDGGRHEAPPVAIGAQDVAYVMYTSGSTGVPKGV
AVPHGSVAALASDPGWAQGPADRVLLHASHAFDASLVEIWVPLVSGAGVVVAEPGTVDAE
RLRDAISRGVTTVHLTAGAFRAVAEEAPESFRGLREILTGGDAVPLASVERMRRACPDVR
FRQLYGPTEITLCATWLVLEPGEETGGILPIGGPLAGRRAYVLDAFLQPVAPEVTGELYL
AGAGLAHGYLGNTAATSERFIADPFTDGGRLYRTGDLARWTAHGELVFGGRADSQVKIRG
YRVEPGEIEAALTEVPDVAQAVVVAREERPGEKRLIAYVTAESGRGLESAEVRAQLAARL
PEFMVPAVVLVLDGFPLTLNGKIDRAALPAPEFTPRAAGREPRTETERVLCGLFAELLGL
DRVGADDGFFELGGDSILSMRLAARARRENLVFGAKQVFEHKTPAGIAMVAEHGGRIRDE
DTEGIGEVPLTPVMRALLERDPRGLTREGMAQWVIVEVPGDLSVPALAAGLSAVLDTHDL
LRSRIVETEGAEPRLIVADRGTVDAATLVERVDAAAGDLGEIAQAAAARLDPLAGVMVRA
VWADAGKGRAGRLVVAAHHLVVDVVSWRTLLPDLQTACEAAVAGVRPSLDPPDVSFRRWS
RTLTEEAATRTAELPTWTEILDGAKPRLGELDPMCDTVSTAGRRSWTVPREHAGTLAEKV
TSAFHCGVHEVLLATLAGAVASWRGGADVVVDVEGHGRQPLGELDPSRTLGWFTDIHPLR
LDTTGADPAEAIAGGAAAGRLLKQVKENVRAVPDGGLGYGLLRHLNAETAPVLAALPKAE
IGFNYLGRFSSRSGGDAKPWQITGIAGGAAEPETPLRHVLEIDAVVVDGADGPEFSLTVT
WARRILDDAGAESFAEAWLAMLTGLAVHAGREGAGGHTPSDFPLTALTQREVTEVEAAVP
NLFDIWPLSPLQEGLLFHATDERGPDVYASMRKLALDGPLDVARFRASWQALLDRHPALR
ASFRQLESGKSVQVIAREVTLPWRETDLSGLPEDAALAEFDRLAAELHAERFDPAQGPLL
RLHLVRLGDRRHRLIFTSHHIVADGWSLPIIADGVLTAYEAGGDVRALPAATSYRDYLAW
IARQDKTAAREAWRDELAGLDEATHVVPPESIITPVEPERVGFELDDETSRRLVEFTRLH
GVTANTLFQGIWALHLAWPAGRNEVVFGAAVAGRPPEIPGVESAVGLFMNMVPVRARLTG
AEPVVDMLKDLQERQVTMMSHQHIGLSEIKQLAGPGAAFDTIVVFENYPYSPPRSGGPDT
LVMRSTGIPNDTGHYPLSLRASVAGGAVRGEFIYRPDVVDRTGAGEMLATLLRALDQVLA
EPRTPVGRIGLIGPEQRRLVVDEWNRTDAPLTADTLPVVFRGQAERTPDAMAVQDGTRSL
SYRGLLDEVEALASLLVRSGVRREDRVGVLVERSAELVVTLMAVSFAGGVFVPVDPDYPR
ERVEFMLANSAPGVLVCTTTTRSAVPAEFAGTVLVLDELPTAGPAVDLPPVAPEDAAYVI
YTSGSTGVPKGVLVTHSGLVNLGYAHIERMAVTSSSRILQLSAIGFDAIVSELYMSFLAG
ATLVLPDAANMPPRMTLGETIRRADITHLTVSPSVLASEDDLPDTLRTVLTGGEALPPAL
VDRWSPGRRVIQAYGPTETTICSTMSAPLSPGHEQVPLGGPIHNVRHYVLDTFLRPVPPG
VVGELYITGVGLARGYLGRPGLTAERFVASPFAPGERMYRSGDLFRWTREGQLLFAGRVD
AQVKVRGYRVEPAEIEAVLAEHPGVGQVVVSVRRDGPGDKQLVAYVVPSADAEGEDLMSA
LRELAAERLPEYMMPAAFVPLEQMPLTPNGKLDHRALRAPDFAGMSSKRDPRTAMEARLC
ELFAEVLGLQQVAPDDSFFELGGDSITSMQLSARARRTGLELTPWQVFEEKTPERLAVLV
KDLPAEGAETAAPEPAAGTLVELSSDQMDQLVAGLAGD
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase B]
ATGAACCAGTCGCGGATTGAGGAAATCTGGCCGCTGTCGCCATTGCAGGCCGGGTTGCTC
TTCCACGCGGTTTACGACGGCGAAGGGCCCGACGTCTACATAGGACACTGGATCCTGGAC
CTGACCGGGCCGGTGGACGCGCCCAGGCTGCGCGCGGCCTGGGAGACGCTGCTCGCGCGG
CACGCCCCGCTCCGGGCCTGCTTCCGGCAGCGCAAATCGGGTGAGACGGTGCAGATCATC
GCCCGGCAGGTCGACCTGCCGTGGCGGGAGATCGACCTTTCCCACCTCGACGACCCCGAG
AAGGCCGTGCGGGAGCTGGCCGAAGAGGACCGGACGACGAGGTTCGACCTCGCGCAGGCG
CCGTTGCTGCGGCTGACTTTCCTCCGTCTCGGCGACGACACGTACCGCCTGGTGGTGACC
TGCCACCACACGATCATGGACGGCTGGTCGCTGCCCATCGTGCTGGACGAGATGTCGAAG
CTGTACGCGGCAGACGGCGAATCGCCGGGCCTGCCGGAAGTGACGTCCTATCGCGACTAT
CTCGCGTGGCTGGGCAGGCAGGACAAGGAGAAGTCGCTCGCCGCCTGGGCGGAACGCCTG
CGCGGAGTCGACGAGCCGACGCTGGTGGTGCCCGCCGATCCGGGCCGTGCGCCCGCCGAA
CCGGAGAGCGTCGAGGTCGGGCTGCCGGAGAACCTCACGCGATCGCTGGGCGAACTCGCC
CGCGCTCACGGGCTGACGCTGAACACGGTGGTGCAGGGCGCGTGGGCGCTGGTGCTGGCG
CAGCTCGCGGGCCGGACCGACGTGGTGTTCGGCGCGGCGGTCTCGGCGCGCCCGCCGGAT
CTGCCCGGCGTGGAAGGCATGGTCGGGTTGTTCCTCAACACCGTTCCCGTGCGCGTGCGC
CTGTCCGGCGCGACGCCGGTCGTCGAGCTGCTGACGGAAGTGCAGCGACGGCAGTCGGCG
CTCATCCCCGACCAGTACGTGGGGCTGGCGGACATCCAGCAGGCCGTCGGTCCCGGCGCG
GTCTTCGACACGTTGATCGTCTTCGAGAAGTTCCACCACGATTCCGGCGAACTGGGTTCC
GCGGACACCTTCGGCATCCAGGTCCATCAGGGCCGGGTCGCCGCCCACTATCCGCTGACG
CTGGTCGCCGTCCCCGGCGAGTCGATGTACTTCAAGCTGGACTACCTGACGGAGTTCTTC
GACCGGGACGCCGCGCTCGCCATCGCCGAACGCTTCACCGGCGTGCTGCGTCAGCTGACG
CGTGCGGGCGACCTCACGGTGGCCGACGTCGAGGTGGCGAGCGCGGCCGAGCGTGCCTTG
GTGGTCGACGCGTGGGGCGTGACGTCGCAGGCGGCGCCGGGCGTGCCCGCGCTGGATCTG
TTCGACAGCCAGGTAAAGCGCCGGAGTGACGAGGTGGCGGTCGTCGACGGCGATCGGACG
CTGACCTACGGAGAACTCGCCGGGCAGGCCGAGCGGCTCGCCGGATATCTGCACGACCGG
GGAGTGCGGCGCGGGGACCGGGTGGCCGTGGTGCTGGACCGCTCACCCGAGCTGATCGCG
ACCCTGCTCGCGGTGTGGAAGGCGGGCGCGGCCTACGTGCCGGTGGATCCCGCCTATCCG
GTGGACCGCGTGCAGTTCATGCTGGCGGATTCCGCGCCCGCGGCGGTGGTGTGCGCGGAG
CGGTACCGGGACGCCGTGCTGGACACCGGCCTCGCCCCGGTCATCCTGGACGATCCGCGT
ACGCGGCGGGAGGTGGCGGACTCCGCTCGCCTGTCGGCCGTCACGAGTGCCGACGACCTC
GCGTACGTGATGTACACGTCTGGTTCGACGGGGACGCCGAAGGGCGTCGCCGTGTCGCAC
GCCAACGTCGCGGCGCTGGCCGGTGAACCGGGATGGCGGGTGGGTCCCGGCGATGCCGTG
CTGCTGCATGCCTCGCACGCCTTCGACATCTCGCTGTTCGAGCTGTGGGTGCCGCTGCTG
TCGGGCGCCAGGGTGGTGCTGGCCGGATCGGGTGCGGTGGACGGCGCGGCGCTGGCCGCC
CATGTGGCCGCCGGTGTCACGGCCGCCCACCTGACCGCGGGGGCCTTCCGGGTACTGGCC
GACGAGTCGCCGGAATCCGTCGCCGGGCTGCGCGAGGTGCTGACCGGTGGCGACGCGGTG
CCGCTCGCGGCGGTGGAACGCGTCCGCCGGGTGTGCCCGGACGTGCGGGTGCGTCATCTC
TACGGCCCGACCGAGGCCACGCTGTGCGCGACGTGGTGGCTGCTCGAACCCGGTGACGAG
ACGGGCGCGGTACTGCCGATCGGCCGTCCGCTCGCGGGGCGGCGGGTCTACGTCCTCGAC
GCGTTCCTGCGGCCCGTGCCCGCCGGGGTGGCCGGCGAGCTGTACGTCGCCGGAGCCGGT
GTGGCGCGGGGATATCTGGGCCGTCCGGTGCTGACGGCGGAGCGGTTCGTCGCCGATCCG
TTCGTGCCTGCCGGGCGGATGTACCGGACCGGGGACCTGGCGTACTGGACGGATCAGGGC
ACGCTGGCCTTCGCCGGACGGGCCGACGACCAGGTGAAGATCCGCGGCTACCGGGTCGAG
CCCGGCGAGATCGAGGCGGTCCTCGCCGGCCTGCCGGGGGTCGGCCAGGCCGTGGTGCTG
GCCAAGGGCGAGCACCTGATCGGGTATGTGGTCGCCGAAGCGGGACAGGACGCCGATCCG
GCGCGGCTGCGCGAACTGCTCGCCGAGACGCTGCCCGAGTTCATGGTCCCGGCCGTCGTC
CTGGTGCTGGACGAATTGCCGTTGACGGTCAACGGAAAGGTGGACCGGCGGGCACTGCCC
GAACCGGACTTCGCGTCGAAGTCGGCGAGCCGGGAACCGGTCACCGAAGCCGAACGAGTC
CTTTGTGGAGTGTTCGCCGACGTGCTCGGTCTCGACCGGGTCGGTGTCGGGGACAGCTTC
TTCGAGCTGGGCGGCGACTCGATCTCCTCGATGCAGGTCGCCGCTCGTGCACGTCGCGAA
GGGATTTCCCTTACCCCGAGGCAGGTTTTCGAGCACCGGACACCCGAACGGCTCGCGGCC
CTCGCCCAGGAGGCCGTCACGGCGCCCCGCGCCGAGGCCGTCACCGGCGTGGGCGAGATC
CCGCGGACGCCGGTGATGCGGGCGCTCGGGGAAGACGCGCTGCGCCCCGGTTTCGCCCAG
GCGAGGGTCGTCGTCACCCCGGCGGGGATGAACCCGGAAGCGCTGGTGGGCGCCCTGCAG
GCGGTGCTGGACACACATGATCTGCTGCGGGCGCGGGTCGAGCCGGACGGACGGCTGATC
GTGCCCGAGCGCGGTGCGATGGACGCGGCCGGTCTGGTCACGCGGGTCGCCGGGACGGGC
GACCTCGACGAGATCGCCGAGCGCGAGGTCAGGACGGCGACGGGCACGCTGAACCCGGCG
GCGGGCATCATGGCGCGGGTCGTGTGGGTCGACGCCGGGGACGCCGAGCGGGGCCGGCTG
GCGTTCGTGGCGCACCACCTCGCGGTCGACGCGGTCTCGTGGGGCATTCTCCTGCCGGAT
CTGCGGGCGGCCTACGACGCGGTCGTCTCCGGCGGGACCCCTGCCCTGGAAGCCCCGGTG
ACGTCGTATCGGCAGTGGGCGCTGCGGCAGACCGAACAGGCGCTCAGCGAGCGCACCGTG
GCCGAACTCGACCAGTGGGTCGCCCTGCTGGACGGCGCGGACCCGGCACCGGCGGGTGAC
TCCGGGCAGGCGCACTCGTGGTCCACGAGGCTGTCCGGCACCGAAGTGCGCACCCTGGTT
GCCCAGTTGCCGGGCGCGTTCCACTGCGGGATCCAGGATGTCCTCCTGGCGGGCCTCGCG
GCCGCGGTGGCGCGGGTGCGCGGTACCGGCGCCGGGTTGCTCGTGGACGTGGAAGGACAT
GGCCGCGAAGCCGCCGACGGCGAGGACCTGCTGCGCACAGTGGGCTGGTTCACCAGCGTC
CACCCGGTCCGCTTCGATCTGTCCGATGTGGACCTCGCGGCCGCCGGACGGTTGCTGAAG
ACCGTGAAGGAACAGATCCGCGCCGTGCCCGGCGACGGATCCGGCTATGGGCTGTTGCGC
CACCTCAATCCCGACACCGGGGCGAAGCTGGCCAAGTCGCCGTCGGCGAGGATCGGCTTC
AACTATCTCGGCCGGACCGTCCTCGCCCCGCGGGCCACCGCGTGGGAGCCGGTGGGCGAA
GGCCCGCTCGGGGCGGGTCCGGACATGGTCCTCGCGCACGCCGTCGAGGTCAGCGCGGAG
GTCCAGGACACGCCTGCCGGACCTCGGCTGGGGCTGGCCATCGACGCACGGGACGCCGAC
CCCGCCACGGTGGAGCGCCTCGGCGAAGCCTGGCTGGAGACGCTGACCGCTCTCGCGGCT
CTCGCCGGGGATCCCGCCGCGGGCGGGCACACGCCGTCCGACTTCGATCTCGTCGGCCTG
ACTCAGCAGGACGTGACGGAGCTGGAGGCCGCGGCCCCGGGGCTGACGGACATCTGGCCC
CTGTCGCCGCTGCAGGAAGGCATGCTCTTCGAACGGGACTTCGACGCCGACGGGGTCGAC
GTCTACCAGAGCCAGCGGATCCTGGACCTCGACGGGCCACTCGACGCGGAACGGCTGCGC
GCGGCCTGGGACCGGGTCCTCGCCCGGCACGCGTCGCTGCGCACCGGTTTTCACCAGCTG
GGGTCCGGCGAAACGGTGCAGGTCGTCGCCGGTGACGTCGAACTCCCTTGGCGGACGGTG
GATCTTTCGTCTCTCGACGAGGCGGCCGCGGCCGCCGAGGTCGAGCGGCTGCTGGCGGAG
GACCAGTCCCGGCGGTTCGACGTGACCGCACCGCCGCTGCTGCGGCTGTCGCTGATCCGG
CTCGGCGCCGACCGGCACCGGCTCGTGCTGACGTCGCACCACCTCGTGCTGGACGGCTGG
TCGACACCGCTCGTCGTGGGCGAGGTCTCGATCGCCTACGCGGGTGAGGAGATCCCGTCG
TCGGCACCGTCCTATAAGGACTATCTGGCCTGGCTGGGCGAGCAGGACGAAGACGCGGCG
CGAGCGGCGTGGCGGGCGGAGCTCGCCGGTGCGGACGAACCGTCCCTTGTGGACGCCGAA
GCCGACAAGACGCTGGTGATGCCCGGGGATCACGCCGAATGGGTGGCCGAGGAGACGACG
CGCGCGCTCGCCGAACTGGCCCGGGGCAACGGGTTGACGACGAGCACGATCCTGCAGGCC
GCCTGGGCGCTGGTCCTGGCGCGGCTGGCCGGCCGGACGGACGTGGTGTTCGGCTCGGTG
GTGTCGGGACGCCCGGCGGAGGTGCCGGACGTCGAGCGGATGGTGGGGATGTTCATCAAC
ACCGTCCCGGTCCGCGTGCGGCTCGACGGCGCCCGGCCGGTGCTGGAGCTGTTCCAGGAC
CTGCAGGCGCGCCAGGCGGCGTTGACCGAACACCAGTACCTGGGGCTGCCGGAGATCCAG
AAGGCGGCGGGGACGGGCGCGGTCTTCGACACCATCGTGATGATCGAGAACTACCCGCAC
ACCGCCGACGGTCTCGGCGACGACGGCGGGGTCGCGATCAGTTCCGTCACCACCCGGACC
GGCACCGGCTATCCGCTGACCATGAACGTCAGCCTCGGGGACCGGTTGCGGATCAACGTG
GCCTACCGCCCGGACCGGATCGACGGCGCGACGGCCGCCGAGGTCGCCAGGCAGCTCGTG
CGGGTGCTGGACCAGGTGGTCGCGCGGCCGTCGCTGCCGGTGGGCCGCCTCGGCGTGACG
AGCGAAGCGGCGCGCGCGTCGGTGGTGGAACGCTGGAATGCCACGGGTAAGGCGGCCAGT
GAGACGTCGGTGCTGGAGTTGTTCCGGCGTCAGGCCGGTGCCTCGCCGGACGCGGTGGCG
GTCACGGACGGGGAACGCACCCTGTCCTACGCCGGCCTCGACCGGGAATCCGATCGGCTG
GCCGGGCAGCTCGCGGACGCCGGTGTGCGCCGTGGTGATCGCGTCGGCGTGGTGATGGAC
CGCGGCGCGGATCTGATCGTCGCCCTGCTCGCGGTCTGGAAGGCGGGTGCCGCGCAGGTC
CCGGTGAACGTGGACTACCCGGGGGAACGGATCGAGCGGATGCTGGCCGACGCCGGCGCG
TCGGTCGCGGTCTGCCTCGAAGCGAGCCGCAAGGCGGTGCCGGACGGCGTCTCGCCGGTG
GTCGCGGACGTCCCGGCGATCGACGGCGGGCGGCACGAGGCGCCGCCGGTCGCGATCGGA
GCGCAGGACGTCGCCTACGTGATGTACACGTCCGGGTCGACAGGTGTGCCGAAGGGCGTC
GCGGTGCCGCACGGCAGTGTGGCGGCACTGGCGAGCGACCCGGGCTGGGCGCAGGGGCCT
GCGGATCGCGTACTGCTGCACGCGTCGCACGCGTTCGACGCGTCGCTGGTCGAGATCTGG
GTGCCGCTGGTCAGCGGGGCCGGCGTGGTGGTCGCGGAACCGGGCACGGTCGACGCGGAA
CGGCTTCGCGACGCGATCTCCCGCGGCGTGACCACCGTCCACCTGACGGCGGGCGCTTTC
CGTGCGGTGGCCGAGGAAGCACCGGAGTCCTTCCGCGGCCTGCGCGAGATCCTGACCGGT
GGGGACGCGGTACCGCTCGCCTCCGTCGAGCGGATGCGCCGGGCGTGCCCGGACGTCCGG
TTCCGGCAGCTCTACGGCCCGACCGAGATCACCCTCTGCGCCACCTGGCTCGTCCTCGAA
CCGGGGGAGGAGACGGGCGGCATCCTGCCGATCGGCGGTCCGCTGGCCGGACGGCGGGCC
TACGTACTCGACGCGTTCCTGCAGCCGGTGGCACCGGAGGTCACCGGCGAGCTGTACCTC
GCCGGTGCCGGATTGGCGCACGGCTACCTGGGCAACACCGCGGCGACGTCGGAGCGGTTC
ATCGCCGACCCGTTCACCGACGGCGGGCGGCTGTACCGCACCGGCGACCTGGCGCGCTGG
ACGGCTCATGGCGAGCTGGTCTTCGGCGGGCGCGCCGACTCCCAGGTGAAGATCCGGGGC
TACCGGGTCGAACCCGGCGAGATCGAGGCGGCGCTGACCGAGGTCCCCGACGTCGCACAG
GCGGTCGTGGTGGCCAGGGAAGAACGGCCCGGCGAAAAGCGGCTGATCGCGTACGTGACC
GCGGAATCGGGGCGGGGGCTGGAATCCGCCGAGGTTCGCGCGCAGCTCGCGGCGCGGTTG
CCGGAGTTCATGGTGCCCGCGGTGGTGCTGGTGCTGGACGGTTTCCCGTTGACACTCAAC
GGGAAGATCGACCGCGCGGCCCTGCCCGCCCCCGAGTTCACGCCGAGAGCGGCCGGTCGC
GAACCCCGCACGGAGACCGAGCGGGTGCTGTGCGGGCTGTTCGCCGAGCTGCTCGGACTG
GACCGGGTCGGCGCCGACGACGGTTTCTTCGAACTGGGCGGGGATTCGATCCTCTCGATG
CGGTTGGCCGCCCGCGCTCGTCGCGAGAATCTCGTCTTCGGGGCGAAACAGGTCTTCGAG
CACAAGACTCCCGCCGGGATCGCGATGGTCGCCGAGCACGGCGGACGGATTCGGGACGAG
GACACCGAAGGGATCGGCGAAGTCCCGTTGACGCCGGTGATGCGGGCGCTGCTCGAACGC
GATCCGCGCGGGCTGACCCGTGAGGGCATGGCGCAGTGGGTGATCGTGGAGGTGCCCGGC
GACCTTTCCGTGCCCGCGCTGGCGGCCGGTCTGAGCGCGGTGCTCGACACGCACGATCTG
CTGCGGAGCCGGATCGTCGAGACCGAGGGCGCGGAGCCCCGGCTGATCGTGGCCGACCGG
GGAACGGTCGACGCGGCGACGCTGGTCGAACGGGTCGACGCCGCCGCGGGCGATCTCGGT
GAGATCGCGCAAGCCGCGGCGGCCCGCCTCGATCCCCTCGCCGGGGTGATGGTCCGCGCG
GTCTGGGCGGACGCGGGCAAGGGCCGCGCCGGGCGGCTCGTGGTGGCCGCGCACCACCTC
GTGGTCGACGTGGTGTCGTGGCGGACCCTGCTTCCGGACCTGCAGACGGCCTGTGAAGCC
GCGGTCGCGGGCGTGCGGCCGTCGCTCGACCCGCCGGACGTCTCGTTCCGGCGCTGGTCG
CGAACGCTGACCGAAGAAGCGGCGACCAGGACCGCGGAACTGCCGACGTGGACGGAGATC
CTCGACGGGGCCAAGCCGCGGCTGGGCGAGCTCGATCCGATGTGCGACACCGTGTCGACC
GCGGGACGCCGGTCCTGGACCGTGCCGCGGGAACACGCGGGCACGCTCGCCGAGAAGGTC
ACCTCGGCCTTCCACTGCGGTGTCCACGAGGTGCTGCTGGCCACCCTCGCCGGTGCGGTG
GCGAGCTGGCGCGGCGGCGCCGACGTCGTGGTCGACGTCGAAGGGCACGGCCGTCAGCCG
CTCGGGGAGCTGGACCCGTCCCGGACACTCGGCTGGTTCACCGACATCCATCCGCTCCGG
CTGGACACGACCGGGGCCGACCCGGCCGAGGCGATCGCGGGCGGGGCCGCCGCCGGGCGG
TTACTCAAGCAGGTCAAGGAAAACGTGCGAGCCGTACCCGACGGCGGGCTCGGTTACGGA
CTGCTGCGCCACCTCAACGCCGAGACGGCGCCGGTGCTCGCTGCGCTGCCGAAGGCGGAG
ATCGGGTTCAACTACCTCGGCCGCTTCTCGTCGCGGTCCGGCGGTGACGCGAAGCCTTGG
CAGATCACGGGAATCGCCGGTGGCGCGGCGGAGCCGGAAACGCCGTTGCGGCACGTCCTG
GAGATCGACGCCGTCGTGGTGGACGGCGCGGACGGCCCCGAGTTCAGCCTGACCGTGACC
TGGGCACGGCGGATCCTCGACGACGCCGGGGCCGAGTCGTTCGCCGAGGCGTGGCTGGCC
ATGTTGACCGGGCTCGCCGTCCACGCCGGCCGCGAAGGCGCCGGTGGGCACACGCCGTCG
GACTTCCCGCTCACCGCGCTGACCCAGCGCGAGGTGACGGAGGTCGAGGCCGCCGTGCCG
AACCTGTTCGACATCTGGCCGCTCTCCCCGCTCCAGGAGGGCTTGCTGTTCCACGCCACC
GACGAGCGCGGCCCGGACGTCTACGCGAGCATGCGGAAACTCGCCCTCGACGGTCCGCTG
GACGTCGCCCGCTTCCGCGCGTCCTGGCAGGCCCTGCTCGACCGGCATCCCGCCCTGCGG
GCGAGTTTCCGGCAGCTGGAGTCCGGCAAGTCCGTGCAGGTGATCGCCCGCGAGGTGACG
TTGCCCTGGCGGGAGACCGACCTTTCCGGGCTTCCCGAGGACGCGGCGCTGGCCGAATTC
GACCGGCTCGCGGCGGAACTGCACGCCGAACGCTTCGACCCGGCGCAGGGACCGTTGCTG
CGCCTGCACTTGGTGCGCCTCGGCGACCGCAGGCACCGGCTGATCTTCACCTCGCACCAC
ATCGTGGCCGACGGCTGGTCGCTGCCGATCATCGCCGACGGGGTGCTGACGGCGTACGAA
GCGGGCGGTGACGTCCGGGCGCTGCCCGCGGCGACGTCGTATCGCGACTACCTCGCCTGG
ATCGCCCGTCAGGACAAGACGGCCGCCCGGGAGGCGTGGCGGGACGAACTCGCGGGTCTC
GACGAGGCGACCCACGTCGTGCCGCCGGAGTCGATCATCACGCCGGTCGAGCCCGAACGC
GTCGGGTTCGAACTCGACGACGAGACGAGCAGGCGCCTGGTGGAGTTCACCCGGCTCCAC
GGCGTCACGGCGAACACCCTCTTCCAGGGGATCTGGGCACTGCATCTGGCCTGGCCCGCC
GGACGGAACGAGGTGGTCTTCGGTGCCGCGGTCGCGGGGCGCCCGCCGGAGATCCCCGGC
GTCGAGTCCGCGGTCGGCCTGTTCATGAACATGGTGCCGGTCCGGGCCCGCCTCACCGGC
GCCGAACCGGTCGTCGACATGCTGAAGGACCTGCAGGAACGGCAGGTCACGATGATGTCG
CACCAGCACATCGGGCTGTCCGAGATCAAACAGCTCGCCGGTCCGGGGGCGGCGTTCGAC
ACGATCGTGGTGTTCGAGAACTATCCGTACTCGCCGCCCAGGTCCGGCGGCCCCGACACG
CTCGTCATGCGCTCCACGGGGATTCCCAACGACACCGGGCACTATCCGTTGTCCCTGCGC
GCGTCCGTCGCGGGCGGCGCCGTCCGCGGTGAGTTCATCTACCGGCCGGACGTGGTCGAC
CGGACCGGGGCCGGGGAGATGCTCGCGACGCTCCTGCGCGCACTCGACCAGGTGCTCGCC
GAGCCGCGGACGCCGGTGGGCCGGATCGGCTTGATCGGCCCGGAGCAGCGTCGTCTGGTG
GTGGACGAGTGGAACCGGACCGACGCGCCGCTCACCGCGGACACGCTGCCGGTGGTGTTC
CGCGGGCAGGCGGAGCGCACGCCGGACGCGATGGCCGTCCAGGACGGGACGCGGAGCCTG
TCCTACCGCGGCCTGCTCGACGAGGTCGAGGCGCTGGCGAGCCTGCTCGTCCGGTCGGGC
GTGCGGCGTGAGGACCGCGTGGGTGTCCTGGTCGAACGCTCGGCCGAGCTGGTCGTGACC
CTGATGGCGGTGTCGTTCGCCGGTGGGGTGTTCGTGCCGGTCGACCCGGACTATCCCCGT
GAACGCGTCGAATTCATGCTGGCCAACTCGGCACCCGGGGTGCTGGTGTGCACGACGACG
ACCCGGTCGGCCGTCCCCGCGGAGTTCGCGGGCACGGTGCTGGTGCTCGACGAGCTGCCC
ACCGCCGGTCCTGCCGTCGATTTGCCGCCGGTGGCACCGGAAGACGCGGCGTACGTCATC
TACACGTCGGGGTCGACAGGGGTGCCCAAGGGTGTTCTCGTCACCCACTCCGGCCTCGTC
AACCTGGGGTACGCGCATATCGAGCGGATGGCCGTCACGTCGTCCTCGCGGATCCTGCAG
CTGTCCGCGATCGGCTTCGACGCCATCGTCTCCGAGCTCTACATGTCCTTCCTGGCCGGC
GCGACCCTGGTCCTGCCGGACGCGGCGAACATGCCGCCCCGGATGACGCTGGGCGAAACG
ATCCGCCGGGCGGACATCACCCACCTGACCGTGTCGCCGAGTGTGCTGGCGAGCGAGGAC
GACCTGCCGGACACCCTGCGGACCGTCCTGACGGGCGGCGAGGCCCTGCCGCCCGCGCTG
GTGGACCGCTGGTCGCCGGGCCGCCGGGTGATCCAGGCCTACGGGCCGACCGAGACCACC
ATCTGCTCGACGATGAGTGCCCCGTTGTCCCCGGGCCACGAACAGGTCCCGCTCGGCGGC
CCGATCCACAACGTGCGGCACTACGTGCTCGACACCTTCCTGCGGCCGGTGCCGCCGGGC
GTGGTCGGCGAGCTCTACATCACGGGTGTCGGACTGGCTCGCGGCTACCTCGGCCGCCCC
GGCCTGACCGCGGAACGGTTCGTCGCCAGCCCGTTCGCGCCCGGTGAGCGGATGTACCGC
TCCGGCGACCTGTTCCGCTGGACCCGGGAAGGCCAGCTGCTCTTCGCGGGCCGGGTCGAC
GCGCAGGTCAAGGTGCGCGGATACCGGGTCGAGCCCGCCGAGATCGAGGCCGTGCTCGCG
GAGCATCCGGGGGTCGGCCAGGTGGTGGTCTCGGTCCGCCGGGACGGGCCGGGTGACAAG
CAGCTGGTCGCCTACGTCGTGCCATCGGCCGACGCCGAAGGCGAAGACCTGATGTCCGCA
CTGCGCGAACTGGCGGCCGAACGCCTGCCGGAGTACATGATGCCGGCGGCCTTCGTGCCG
CTGGAGCAGATGCCGCTCACCCCGAACGGCAAGCTCGACCACCGCGCGCTGCGGGCCCCC
GACTTCGCCGGGATGTCCTCGAAACGAGACCCGCGCACGGCCATGGAGGCGCGGCTGTGC
GAGCTGTTCGCGGAAGTGCTGGGGCTCCAGCAGGTGGCTCCCGACGACAGCTTCTTCGAA
CTCGGCGGCGACTCGATCACCTCGATGCAGTTGTCGGCCAGGGCCCGCCGGACGGGACTG
GAACTGACGCCGTGGCAGGTGTTCGAAGAGAAGACACCGGAACGGCTGGCGGTCCTCGTC
AAGGACCTCCCGGCCGAGGGCGCGGAAACCGCGGCGCCGGAGCCCGCCGCGGGCACGCTC
GTGGAACTTTCCTCTGACCAGATGGACCAGCTCGTGGCCGGACTGGCCGGTGACTGA
[4] C7..301
[4] A482..879
[4] L-4-hydroxyphenylglycine(Hpg)649..749
[4] PCP957..1023
[4] E1060..1488
[5] C1497..1788
[5] A1969..2363
[5] L-4-hydroxyphenylglycine(Hpg)2133..2233
[5] PCP2446..2512
[5] E2549..2994
[6] C3006..3297
[6] A3481..3870
[6] beta-hydroxytyrosine(Bht)3647..3742
[6] PCP3955..4021
[4] C19..903
[4] A1444..2637
[4] L-4-hydroxyphenylglycine(Hpg)1945..2247
[4] PCP2869..3069
[4] E3178..4464
[5] C4489..5364
[5] A5905..7089
[5] L-4-hydroxyphenylglycine(Hpg)6397..6699
[5] PCP7336..7536
[5] E7645..8982
[6] C9016..9891
[6] A10441..11610
[6] beta-hydroxytyrosine(Bht)10939..11226
[6] PCP11863..12063

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [482-879]  2.4e-113 PF00501 [1969-2363]  6.6e-105 PF00501 [3481-3870]  4.6e-109 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  5.4e-65 PF00668 [1060-1327]  3.1e-31 PF00668 [1497-1788]  1.9e-67 PF00668 [2549-2822]  1.6e-32 PF00668 [3006-3297]  1.6e-58 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [982-997]  PS00012 [2471-2486]  PS00012 [3980-3995]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1023]  19.272 PS50075 [2446-2512]  17.333 PS50075 [3955-4021]  19.294 PS50075
PS50075   ACP_DOMAIN
 [960-1021]  6.5e-13 PF00550 [2449-2508]  6e-10 PF00550 [3958-4017]  7.9e-12 PF00550
PF00550   PP-binding
 [950-1024]  8.6e-19 SSF47336 [2439-2513]  7.8e-17 SSF47336 [3948-4022]  4.9e-18 SSF47336
SSF47336   ACP-like
 [947-1024]  1.5e-23 G3DSA:1.10.1200.10 [2437-2511]  3e-21 G3DSA:1.10.1200.10 [3947-4022]  1.3e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1335-1488]  5.5e-29 TIGR01720 [2838-2994]  5.8e-40 TIGR01720
TIGR01720   NRPS-para261: non-ribosomal peptide synthase domai
IPR010071 Amino acid adenylation domain (Domain)
 [482-879]  2.1e-132 TIGR01733 [1969-2363]  4.6e-122 TIGR01733 [3481-3870]  5.7e-125 TIGR01733
TIGR01733   AA-adenyl-dom: amino acid adenylation domain
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [958-1026]  5.2e-10 SM00823 [2447-2514]  0.008 SM00823 [3956-4024]  3.9e-05 SM00823
SM00823   Phosphopantetheine attachment site
IPR020845 AMP-binding, conserved site (Conserved_site)
 [603-614]  PS00455 [2087-2098]  PS00455 [3599-3610]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit