close all open/close all

CDS information : Vanco_00100


close this sectionLocation

Organism
StrainATCC 19795 (=NBRC 12806)
Entry nameVancomycin
Contig
Start / Stop / Direction31,323 / 36,914 / + [in whole cluster]
31,323 / 36,914 / + [in contig]
Location31323..36914 [in whole cluster]
31323..36914 [in contig]
TypeCDS
Length5,592 bp (1,863 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase C
Gene
Gene (GenBank)vpsC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
R4T047
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
Q939Y9
NITE
Balhi_00090
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[17506888] Phylogenetic analysis of condensation domains in NRPS sheds light on their functional evolution. (BMC Evol Biol. , 2007)
ACC
Q70AZ6
NITE
Teicp2_00210
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

A7 L-3,5-dihydroxyphenylglycine(Dpg)
C15..313
A496..891
PCP974..1041
X1055..1354
TE1627..1844

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase C]
MTVDDTRAKPRSSVEDVWPLSPLQEGMLFHTVLDKEGPDTYTVQTVYGIDGPLDAGLLKR
SWQALVDRHAALRACFRYVSGAQMVQVIARNAEIPWRETDLSGLPGDGADGVESAVDRLA
ADEVAERLSIESAPLMKLHLIRLGPESHRLVHTLHHVLVDGWSMPILHRELAEIYAAGGD
ASGLPPTVSYRDYLAWLGRQDKEAARAAWRAEFAGLETPTTVVPADPTRIPDIHTEVVEL
SAELTDGLARLARGNGLTLNTVVQGAWAVVLSQLAGRTDVVFGATASGRPADLPGVESMV
GQLLNTLPVRVRLDGARRAVELFADLQRDQAALMAHQYLGLQDVRTVAGPGAVFDTLVIY
ENFPRTGLDRPSDGGLNLRPVKRGSNSSHYPFTLVTGPGERMPLILDYDHGLFDRTAAES
VVGAMARVLERLVAEPDVLIGRLPTVSEAERALVLNDFNATAGPVPGESVPALFARRVAA
APEAVAIVDAHGANLTYAEIDQASDRLAGHLAGRGVGRGDRVGVAMERSPELIIAFLAIW
KAGAAYVPVDVEYPAERISFILEDSGVSTVLCTEATRAVAFSGLNAIVLDAPETRAAVDV
CAAPEIRLSADDLAYVMYTSGSTGLPKGVGIPHGAVAGLAGDEGWQIGAGDGVLMHATHV
FDPSLYAMWVPLVSGARVLLTEPGVLDAAGVRQAVRRGATYVHLTAGTFRALAETSPECF
DGLVEIGTGGDIVPLQSVENLRRAQPGLRVRNTYGPTETTLCATWLPIEPGDVLDRELPI
GHPMTNRRIYILDAFLRPVAPGVAGELYIAGTGLARGYLNAPGLTAGRFVACPFAAGERM
YRTGDLARWTRDGEVVFLGRADDQVKIRGYRVELGEVEAVLAAQPGVVEAVLLAREDQPG
EKRLVGYFVSDGGDAGPEEIRRQMAKVLPDYMVPIAVVALPGLPVTPNGKVDRRALPAPD
LAGGSSEKAPENETEKVLCALFAEILSVDQVGVDDAFQDLGGSSALAMRLVARIREELGE
DLPIRQLFSSPTPAGLARALAAKSRPVLEVAQRPERVPLTARQLRAWLLADPGGETASLT
TSVALRLHGRLDVPALTAALGDVAARHELLRTTFPGDAQSVHQHVHDTLAVELTPVAATE
DDLPGLLAELRESVFDLTREVPWRCDLFALSEKEHVLHLRVHRILADDDSLDVFFRDLAA
AYGARREGRVPQRAPLALQFADYSLWERRLLEDEDEPGSLVNEQVAFWRDNLAGIDGETV
LPFDRPRPAVPSRRAGSVALRLDAGPHARLAETAESAGAETLQLVHAALAMLLTRSGSGD
DVVIGTTLPRDEELFDLEPMVGPFTRPLALRTDVSGDPTFLEVVTRVQEAVQATNQHLDV
PFERIVELLDLPASLSRHPVFQVGLEVDEEDIDGWSTAELPALRTGVEPAGTDAMELDLA
VKLTEHFDDDDEAGGLEGALRYATDLFDQATAESVARRLVRVLEQVAEDPRRRVSELDLF
LDDFERGRPPIAPARWAGAVPAVVAELAGDDPVGALVLDELMRPVAPGAVGDLYVTGPAV
DTAPAGLPTVPCPFGEEGHRMLPTGLLARKTPAKTLVVVGERRRASTAVKTGDFEILLPL
RVGGDRPPLFCVHASGGLSWNYEPLLRYLPANQPVYGVQARGLARTEPLPGSVEEMAADY
LAQIRAVQPSGPYHLLGWSLGGRIAQAMARLLEQEGEKVGLLALLDAYPVYMGRKTTGAA
SEEAALSKRNQADLDLAGQLVKSEAARARLEAVMRNLWDIGPRHVSSPFAGDILLFVATV
DRPEHLPVSVAKASWKEFTTGTIEAHDIPSNHYDMVQTAALGQIGSIVAEKLRQRPEGER
TQR
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase C]
GTGACCGTTGACGACACTCGTGCGAAGCCTCGCTCCAGCGTGGAAGACGTCTGGCCGCTT
TCCCCGCTGCAAGAAGGGATGCTCTTCCACACCGTCCTGGACAAGGAGGGACCGGACACC
TACACGGTCCAGACCGTCTACGGGATCGACGGCCCGCTCGACGCGGGGCTGCTGAAGAGG
TCGTGGCAGGCGCTCGTGGACCGGCATGCCGCGCTGCGGGCCTGTTTCCGCTACGTCAGC
GGCGCCCAGATGGTGCAGGTGATCGCGCGGAACGCCGAAATTCCTTGGCGCGAAACGGAT
CTTTCCGGGCTGCCCGGCGACGGTGCCGATGGCGTCGAGAGCGCGGTGGACCGCCTGGCC
GCGGACGAGGTGGCCGAACGGCTGAGCATCGAGTCGGCGCCACTGATGAAACTGCACCTG
ATCCGGCTCGGCCCGGAAAGCCACCGGCTCGTGCACACGCTGCACCACGTCCTCGTGGAC
GGCTGGTCGATGCCGATCCTGCACCGGGAACTCGCCGAGATCTACGCCGCGGGCGGTGAC
GCCTCCGGGCTCCCGCCCACCGTGTCCTATCGGGACTACCTCGCCTGGCTGGGGCGGCAG
GACAAGGAAGCGGCCCGGGCGGCCTGGCGGGCCGAGTTCGCCGGGCTGGAGACCCCCACC
ACGGTCGTCCCCGCCGATCCCACCCGGATACCGGACATCCACACCGAAGTCGTCGAGCTG
TCCGCGGAGCTGACGGACGGCCTCGCCCGGCTGGCGCGCGGCAACGGGCTCACCCTGAAC
ACCGTCGTGCAGGGCGCGTGGGCCGTCGTGCTGTCGCAGCTCGCCGGCCGCACCGACGTG
GTGTTCGGCGCGACCGCCTCGGGGCGGCCCGCCGATCTGCCCGGCGTGGAGTCGATGGTC
GGCCAGCTGCTCAACACCCTGCCGGTGCGGGTCCGGCTCGACGGCGCGCGGCGGGCCGTC
GAGCTGTTCGCCGACCTGCAGCGCGACCAGGCGGCGCTCATGGCGCACCAGTATCTCGGC
CTCCAGGACGTGCGGACCGTCGCCGGACCCGGAGCGGTCTTCGACACGCTCGTCATCTAC
GAGAACTTCCCCCGCACGGGACTCGACCGGCCGTCGGACGGCGGCCTGAACCTGCGCCCG
GTGAAACGGGGGAGCAACTCCTCGCACTATCCGTTCACCCTGGTGACCGGTCCGGGCGAA
CGGATGCCGCTCATCCTCGACTACGACCACGGCCTGTTCGACCGGACGGCCGCCGAATCG
GTCGTCGGCGCGATGGCGCGCGTGCTGGAGCGGCTGGTCGCCGAGCCCGACGTCCTCATC
GGCCGTCTGCCGACAGTGAGCGAGGCCGAGCGCGCCTTGGTGCTGAACGACTTCAATGCG
ACCGCGGGTCCGGTGCCGGGGGAGTCCGTCCCCGCCTTGTTCGCCCGTCGGGTGGCCGCG
GCGCCGGAGGCGGTGGCGATCGTCGATGCCCACGGTGCGAACCTGACCTACGCCGAGATC
GACCAGGCGTCGGATCGGCTGGCGGGCCACCTCGCCGGTCGGGGCGTCGGCCGCGGTGAC
CGCGTCGGCGTGGCCATGGAGAGGTCACCGGAGCTGATCATCGCGTTCCTGGCGATCTGG
AAGGCGGGCGCCGCCTACGTTCCGGTGGACGTCGAGTACCCGGCCGAGCGGATCTCGTTC
ATCCTCGAGGACTCCGGCGTCTCGACCGTCCTGTGCACCGAAGCCACCCGCGCGGTCGCG
TTTAGCGGGCTAAACGCGATCGTGCTCGACGCGCCGGAAACGCGCGCGGCCGTCGACGTC
TGTGCCGCGCCGGAGATCCGGCTGTCCGCGGACGACCTCGCGTATGTCATGTACACCTCC
GGATCCACCGGTCTCCCGAAGGGCGTGGGAATCCCGCACGGTGCAGTCGCCGGGCTGGCG
GGCGACGAGGGCTGGCAGATCGGCGCGGGCGACGGCGTGCTGATGCACGCGACGCACGTC
TTCGACCCGTCGCTCTACGCGATGTGGGTGCCGCTCGTCTCCGGGGCGCGAGTCCTGCTC
ACCGAACCGGGAGTGCTGGACGCGGCCGGGGTCCGGCAGGCCGTGCGCCGCGGCGCGACC
TACGTCCACCTCACCGCCGGTACCTTCCGCGCGCTGGCGGAGACGTCGCCGGAATGCTTC
GACGGCCTGGTCGAGATCGGTACCGGCGGCGACATCGTCCCCCTGCAGTCGGTGGAGAAC
CTGCGGCGGGCCCAGCCCGGTTTGCGGGTGCGCAACACCTACGGTCCGACCGAGACCACC
CTGTGCGCGACGTGGCTGCCGATCGAACCCGGAGACGTACTCGACCGGGAGCTGCCGATC
GGGCATCCGATGACCAACCGCCGGATCTACATCCTCGACGCCTTCCTGCGCCCGGTCGCG
CCGGGTGTGGCGGGCGAGCTGTACATCGCGGGCACGGGCCTGGCCCGGGGGTACCTGAAC
GCGCCGGGCCTGACTGCCGGCCGCTTCGTGGCTTGCCCGTTCGCCGCCGGGGAACGCATG
TACCGCACCGGCGACCTGGCGCGCTGGACCCGTGACGGCGAAGTCGTGTTCCTCGGCCGT
GCGGACGACCAGGTGAAGATCCGCGGTTACCGGGTCGAACTCGGCGAGGTGGAGGCCGTG
CTGGCCGCCCAGCCGGGAGTCGTCGAGGCCGTCCTGCTGGCACGGGAAGACCAGCCCGGC
GAAAAGCGACTGGTCGGCTATTTCGTTTCGGACGGCGGCGACGCGGGACCGGAGGAGATC
CGGCGGCAGATGGCCAAGGTGCTGCCCGACTACATGGTCCCGATCGCGGTCGTCGCGCTG
CCCGGCCTGCCCGTCACCCCCAACGGGAAGGTGGATCGCCGGGCCCTGCCCGCCCCGGAT
CTCGCCGGAGGCTCGTCGGAGAAGGCGCCGGAGAACGAGACCGAAAAGGTGCTGTGCGCG
CTGTTCGCCGAGATCCTCAGCGTCGACCAGGTGGGCGTCGACGACGCCTTCCAGGACCTC
GGCGGCAGTTCGGCGCTGGCCATGCGGCTCGTCGCGCGGATCCGGGAGGAACTCGGCGAA
GACCTGCCCATCCGGCAGTTGTTCTCCTCGCCGACGCCCGCGGGGCTGGCCAGGGCGCTC
GCCGCGAAGTCCCGCCCCGTCCTGGAAGTCGCCCAGCGACCGGAGCGGGTACCGCTCACC
GCCCGCCAGCTGCGCGCCTGGCTGCTGGCCGATCCGGGCGGGGAGACGGCGAGCCTGACC
ACGTCGGTCGCGCTGCGCCTGCACGGCAGGCTCGACGTGCCCGCGCTGACGGCCGCGCTC
GGCGACGTCGCGGCCCGGCACGAGCTTCTCCGCACGACCTTCCCCGGCGACGCGCAGAGC
GTCCACCAGCACGTCCACGACACCCTGGCGGTCGAGCTGACCCCGGTCGCGGCCACCGAG
GACGACCTCCCCGGCTTGCTCGCGGAGCTGCGTGAGTCGGTCTTCGACCTCACTCGGGAG
GTGCCGTGGCGGTGTGACCTTTTCGCGCTCTCGGAGAAGGAGCACGTGCTTCACCTGCGG
GTGCACCGGATCCTCGCCGACGACGACTCGCTGGACGTGTTCTTCCGCGACCTGGCGGCC
GCCTACGGGGCGCGGCGCGAGGGCCGGGTCCCGCAGCGGGCGCCCCTGGCCCTGCAGTTC
GCCGACTACTCGCTCTGGGAGCGGCGTCTGCTCGAGGACGAGGACGAGCCGGGCAGCCTG
GTCAACGAGCAGGTCGCCTTCTGGCGGGACAACCTGGCGGGCATCGACGGGGAGACGGTG
CTCCCGTTCGACCGCCCGCGGCCCGCGGTCCCGTCGCGGAGGGCGGGTTCGGTGGCGCTG
CGGCTGGACGCCGGCCCGCACGCCCGGCTGGCGGAGACGGCGGAGTCGGCGGGCGCGGAG
ACGCTCCAGCTGGTGCACGCCGCGCTCGCCATGCTGCTGACCAGATCCGGGTCGGGCGAC
GACGTGGTGATCGGCACGACGCTGCCGCGGGACGAGGAACTCTTCGACCTCGAACCGATG
GTCGGCCCGTTCACCCGGCCGCTCGCCCTGCGGACGGACGTCTCGGGCGATCCGACCTTC
CTGGAGGTCGTCACCCGGGTGCAGGAGGCCGTCCAGGCCACGAACCAGCACCTGGACGTG
CCCTTCGAACGGATCGTCGAGCTGCTGGATCTGCCTGCCTCGCTCTCCCGCCACCCGGTG
TTCCAGGTGGGACTGGAGGTGGACGAGGAGGACATCGACGGCTGGTCCACGGCGGAATTG
CCCGCGCTGCGCACCGGTGTCGAACCCGCCGGGACCGACGCGATGGAGCTGGATCTCGCG
GTCAAGCTCACCGAGCACTTCGATGACGACGACGAAGCGGGCGGCCTGGAAGGCGCGCTG
CGCTACGCCACCGATCTGTTCGATCAGGCCACGGCCGAATCGGTCGCCCGGCGGCTGGTC
CGCGTCCTCGAACAGGTGGCGGAGGATCCCCGGCGGCGGGTCAGCGAGCTGGACCTCTTC
CTGGACGACTTCGAACGCGGCCGTCCGCCGATCGCCCCGGCGCGGTGGGCGGGTGCCGTC
CCCGCGGTGGTCGCCGAGCTGGCCGGGGACGACCCGGTCGGCGCGCTGGTACTGGACGAG
CTGATGCGCCCCGTCGCGCCAGGCGCCGTCGGCGATCTCTACGTCACCGGTCCGGCGGTG
GACACGGCACCGGCCGGCCTGCCGACCGTGCCCTGTCCGTTCGGCGAGGAAGGGCACCGG
ATGCTGCCGACGGGCCTGCTCGCCCGCAAGACCCCCGCGAAGACCTTGGTCGTCGTGGGG
GAGCGGCGGCGGGCGAGCACCGCGGTGAAGACGGGTGACTTCGAAATCCTGTTGCCGCTC
CGCGTCGGCGGCGACCGCCCGCCGCTGTTCTGTGTCCACGCGAGCGGTGGCCTGAGCTGG
AACTACGAACCGTTGCTGCGGTATCTCCCGGCGAACCAGCCGGTCTACGGCGTGCAGGCA
CGCGGCCTGGCCAGGACGGAACCCCTGCCGGGCAGCGTCGAGGAGATGGCGGCCGACTAC
CTCGCGCAGATCCGCGCCGTGCAGCCGTCCGGGCCGTACCACCTCCTCGGCTGGTCCCTC
GGCGGCCGGATCGCGCAGGCGATGGCCAGGCTGCTGGAGCAGGAAGGGGAGAAGGTCGGC
CTGCTGGCGCTGCTCGACGCCTATCCCGTCTACATGGGACGCAAGACGACCGGCGCCGCG
AGCGAAGAAGCGGCCCTGTCGAAGCGGAACCAGGCGGATCTGGACCTCGCGGGTCAACTG
GTGAAGAGCGAGGCCGCCCGGGCGCGCCTCGAAGCCGTCATGCGGAACCTCTGGGACATC
GGGCCACGGCACGTTTCCTCGCCCTTCGCCGGCGACATCCTGCTCTTCGTGGCCACTGTG
GACCGTCCCGAACATCTTCCCGTCTCGGTGGCGAAAGCCAGCTGGAAGGAGTTCACCACC
GGGACCATCGAGGCCCACGACATCCCGTCCAACCACTACGACATGGTGCAAACCGCGGCG
CTGGGCCAGATTGGATCCATCGTCGCCGAGAAACTCCGGCAGCGGCCGGAAGGTGAAAGG
ACACAACGATGA
[7] C15..313
[7] A496..891
[7] L-3,5-dihydroxyphenylglycine(Dpg)662..762
[7] PCP974..1041
[7] X1055..1354
[7] TE1627..1844
[7] C43..939
[7] A1486..2673
[7] L-3,5-dihydroxyphenylglycine(Dpg)1984..2286
[7] PCP2920..3123
[7] X3163..4062
[7] TE4879..5532

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [496-891]  7.20000000000003e-106 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1627-1844]  9.60000000000003e-38 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [15-313]  5.10000000000004e-63 PF00668 [1055-1354]  1.6e-49 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [967-1042]  2.49999811956465e-19 SSF47336
SSF47336   ACP_like
 [966-1044]  1.1e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [974-1041]  PS50075
PS50075   ACP_DOMAIN
 [977-1040]  5e-13 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [496-891]  1.10000000000001e-126 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [616-627]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit